KEGG   Burkholderia pseudomallei 668: BURPS668_A0209Help
Entry
BURPS668_A0209    CDS       T00481                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BURPS668_A0209
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BURPS668_A0209
Enzymes [BR:bpd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BURPS668_A0209
Two-component system [BR:bpd02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   BURPS668_A0209
Bacterial motility proteins [BR:bpd02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BURPS668_A0209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:193084..194148
Genome map
AA seq 354 aa AA seqDB search
MIRVVVVDDSMSMRTLLERIINGCDGMTCVGAAQDANAAREMIRALDPDVVTLDVEMPGM
DGFEFLRRMMLLKPTPTIMVSGRTTSGSDAALRALELGAVDVIAKPVLTGPADLADYARD
IAELIRGAAAARVKGGVLAAASPARGERACIQRPRGAKKVGIAATRLSRVIAIGASTGGT
EALRAVLQDMSGTPPPILICQHMPEGFTASFAARLDTICGIRVKEAEQGEPLRYGCAYVA
PGHSHLSLAATGRHYVCRLEASPPVNRHRPSVDVLFDSVARLAGKRALGAILTGMGKDGA
AGLLRMRASGARTFAQDEQSCVVFGMPKEAIAMGAVDEILPLARMGARLREALQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
ttgattcgcgtagtggtggtggatgattcgatgtcgatgcgaacgttgctggaacgcatc
atcaatggttgcgacggcatgacctgcgttggcgcggcgcaagacgcgaacgcggcgcgg
gagatgatccgcgcgctcgatcccgacgtcgtcacgctcgacgtcgaaatgccgggcatg
gacggcttcgaattcctgcggcgcatgatgctcctgaagccgaccccgacgatcatggtg
tcgggacgtacgacatccggctccgatgccgcgctgcgcgcactcgagcttggcgcagtc
gacgtgatcgccaagccggtgttgaccgggccggccgatcttgccgactatgcgcgcgac
atcgcggagctgatccgcggcgcggcggccgcacgcgtaaaaggcggtgtgctcgccgcc
gcgtcgcccgcacgaggcgagcgtgcgtgtattcaacggccgcgcggcgcgaagaaggtc
ggcatcgcggcaacgcgtctgagcagggtgatcgcgatcggtgcgtcgacgggcggcacg
gaggcgctcagggccgtgctgcaggacatgagcggcacgccgccgccgattctgatttgc
cagcacatgccggaggggttcacggcttcgttcgccgcccggctcgacacgatctgcggc
attcgcgtcaaggaagcggagcagggcgagccgctgcgctacggctgtgcatatgtcgcg
ccgggccactcgcatctatccctggcggctaccggccgccactacgtctgccggctcgag
gcgtcgccgcccgtcaatcggcaccggccgtcggtcgacgtgctgttcgattcggtcgcg
cgcctcgcgggcaagcgcgcgttgggcgcgattctgaccggcatgggcaaggatggcgcg
gcggggctgctgcgcatgcgagcttcgggagcacggactttcgcgcaggacgagcaatcg
tgcgtggtgttcggcatgccgaaggaggcaatcgcgatgggggcggtggatgaaattctg
ccgcttgcccgcatgggcgcgcggctcagggaagcgttgcaatga

DBGET integrated database retrieval system