KEGG   Burkholderia pseudomallei 668: BURPS668_A0289Help
Entry
BURPS668_A0289    CDS       T00481                                 

Definition
glycosyl hydrolase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BURPS668_A0289
Enzymes [BR:bpd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BURPS668_A0289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(255228..257876)
Genome map
AA seq 882 aa AA seqDB search
MSARHFGFRQAVLVGSLAALAGAAALPANTSAAAEAFGSPGAAPVRGPAAKSFLGTAVNG
ASRVYFTGYRGILSEVYYPVLDTPESVDLQFLVGDAGKTFVDEEKQQAYSAAQTDTRTMS
WQVTTGNSSHNWQIRKIVFADPNHNAIVQRVTFTALNGRKVGDFNLYMLSKPYLDNAGAN
NTAQTVSGSGGTALVANHNSRYSALVASRPWKVVNGVGMTSNGFVGQSDGWTDLLGGTAD
KTMDWTFSSATNGNAAQMGWLDLGDPSATSVSFDVVLGFGGTQDQALGDANTVLGSDLAG
EQQQYDTGWHNYAAGLSSQNGAADDGYYLAAMTLKTMQDKSNGAMIAGIGTPWGETQGDA
NAGGYHLVWPRDLFKFANALTTAGDTSSATSVVNYLFNTLQQTTDCGTAEYNAPGCAQGY
SRVGRFPQNAWVNGWPYWQGTQMDEQAMPIILAWRLGPSVFNPLWPKIKLTADYIVNTGP
WTYQERWEENAGYSPSTIAAEIAGLVTAADIATQNGDTASAARYLAAADYWQENVAAWTY
TSSGAFGNGSYYIRINPAGRAGTGTDRASFAPTAGPDTPQTLSVKNGGGSHDARRVVDGG
FFELVRMGVKRATDPTIANTISVYDSVLGQTLNVANAPALSPNAWFRYNFDGYGEHNDGG
DFDGTGAGRLWPIFTAERGMVEIARQGSGGAGSAYFSTLKQLTTPEGFVPEQVWSNSTTL
PDGWAVTTPAGYTPGQPTKSMAPLNWAMGEYISLLASIQAGRIVDVPSVVCARYNNCAAP
PQSGQVPVAVNVNASTQLGQQMYVTGNVAALGNWNTDLGIPVDPASYPVWRNTVNLPAAQ
AIQYKYYRKNADGSVTWENRSGNRQLQTPASGTLALNDQVSW
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaaggcacttcggattcaggcaggcggtgctggtgggcagtctggccgcgctc
gcgggcgcggcggccctaccggcgaatacttcggccgccgccgaagcattcggctcgccc
ggcgccgcgcccgtgcggggcccggcggccaagtcgttcctcggcacggcggtcaacggc
gcatcgcgggtgtacttcaccggttatcgcggcatcctgtccgaggtctactacccggtc
ctcgatacgcccgagtccgtcgacctgcagttcctcgtcggcgacgccggcaagaccttc
gtcgacgaagaaaagcagcaggcctactcggccgcgcaaacggacacgcgcacgatgagc
tggcaggtgacaaccggcaacagttcgcacaactggcaaattcgcaagatcgtcttcgcc
gatccgaaccacaacgcgatcgtgcagcgcgtcacgttcaccgcgctcaacggccgcaag
gtgggcgacttcaatctctacatgctgtccaagccgtacctcgacaacgccggcgccaac
aataccgcgcaaacggtatccggcagcggcggcaccgcgctcgtcgcgaatcacaacagc
cgctattcggcgctcgtcgcgagccgcccgtggaaggtggtcaacggcgtgggcatgacg
tcgaacggcttcgtcgggcaaagcgacggctggaccgacctgctcggcggcaccgccgac
aagacgatggactggaccttctcgtccgcgaccaacggcaacgccgcgcagatgggctgg
ctcgacctcggcgatccgagcgcgacgagcgtgtcgttcgacgtcgtgctcggcttcggc
ggcacgcaggaccaggcgctcggcgacgcgaacacggtgctcggcagcgatctcgccggc
gagcagcagcagtatgacaccgggtggcataactacgcggcgggcctgtcgtcgcagaac
ggcgccgcggacgacggctactacctggccgcgatgacgctcaagacgatgcaggacaag
agcaacggcgcgatgatcgccggcatcggcacgccgtggggcgaaacgcagggcgatgcg
aacgcgggcggctatcacctcgtgtggccgcgcgacctgttcaagttcgcgaacgcgctg
acgacggcgggcgacacgtcgagcgcgacgagcgtcgtcaactacctgttcaacacgctg
cagcagacgaccgattgcggcaccgccgaatacaacgcgcccggctgcgcgcagggctac
agccgcgtcgggcgctttccgcagaacgcatgggtgaacggctggccgtactggcagggc
acgcagatggacgagcaggcgatgccgatcatcctcgcgtggcgcctcggcccgagcgtg
ttcaatccgctgtggccgaagatcaagctcaccgccgactacatcgtcaataccggcccc
tggacgtaccaggagcgctgggaggagaacgccggctattcgccgtcgacgatcgccgcc
gagatcgcgggcctcgtcacggcggccgacatcgcgacgcaaaacggcgacacggcgagc
gccgcgcgctacctcgccgcggccgactactggcaggagaacgtcgcggcgtggacgtac
acgtcgagcggcgcgttcggcaacggcagctactacatccggatcaatccggcgggccgc
gcgggcaccggcaccgaccgcgcgagcttcgcgccgaccgccggccccgacacgccgcag
acgctgagcgtgaagaacggcggcggcagccacgacgcgcggcgcgtcgtcgacggcggc
ttcttcgagctcgtccgaatgggggtcaagcgcgcgaccgatccgacgatcgccaacacg
atctcggtctacgacagcgtgctcggccagacgctgaacgtcgcgaacgcgccggcgctg
tcgccgaacgcgtggttccgctacaacttcgacggctacggcgagcacaacgacggcggc
gatttcgacggcaccggcgccggccggctgtggccgatcttcaccgccgagcgcggcatg
gtcgagatcgcgcgccagggcagcggcggcgcgggcagcgcgtacttctcgacgctcaag
caattgacgacacccgagggcttcgtgccggagcaggtgtggtcgaattcgacgacgctg
cccgacggctgggcggtgacgacgcccgcgggctacacgccgggccagccgaccaaatcg
atggcgccgctcaactgggcgatgggcgaatacatcagcctgctcgcgtcgatccaggcg
gggcgcatcgtcgacgtgccgtcggtggtctgcgcgcgctacaacaactgcgccgcgccg
ccgcaaagcgggcaggtgccggtggccgtcaacgtgaacgcgagcacgcagctcggccag
cagatgtacgtgacaggcaacgtcgccgcgctcggcaactggaacaccgatctcggcatt
ccggtcgatccggccagctacccggtgtggcgcaacaccgtcaacctgccggccgctcag
gcgatccagtacaagtactaccggaagaacgcagacggcagcgtgacgtgggagaaccgt
tccggcaaccgccagcttcagacgcccgcgagcggcacgttggcgctgaacgatcaggtg
agctggtga

DBGET integrated database retrieval system