KEGG   Burkholderia pseudomallei 668: BURPS668_A0321Help
Entry
BURPS668_A0321    CDS       T00481                                 

Gene name
asnB
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BURPS668_A0321 (asnB)
Enzymes [BR:bpd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BURPS668_A0321 (asnB)
Peptidases [BR:bpd01002]
 Cysteine Peptidases
  Family C44
   BURPS668_A0321 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:283828..285696
Genome map
AA seq 622 aa AA seqDB search
MCGITGWIDFARDLRNEAPIVDTMTDTLARRGPDARGVWLDTHAALGHRRLSIIDPERGA
QPMLTPERGPRGLPRAVISYAGETYNFRELRAELGALGHRFDTHCDTEVVLRAYLEWGAA
FVDRLNGMYSIAIWDTARDELLLVRDRLGVKPLFYYPTADGVIFGSEPKAILAHPDVRAR
TSSEGLCDALLFLRTPGQVPFSGMREVKPGHVLRVRRGGLAEQRYWALEARPHTDDLPTT
IATIRALLDDIVSRQMISDVPLCALLSGGVDSSTIAALAQKRRRASGGGALSTFCVDFTG
HMRNFRADPIRPTADAPFALEVARHIGSDHHTIELDQAGLLDPQVREAVLRAWDLPFNFA
DLDVSLHRLFAEVRKHATVALSGEAADEIFGGYLWFSDPAARRAHTFPWLKLGAHRGLDP
RALFHRSFIDALRLGEYEAQLYRAALAEVPRLDGENAEDRRTRELHYLTLTRWLPVLLDK
KDRMGMASGLEGRVPFCDHRLVEYVFNIPWAMKTFSGQEKALLRAAAADLLPESVLNRKK
AAYPSIQAPGYDRGLIERLNRAIAAGRAPLEPFIDAGALRGLTEKTAAGSLSEFERILLE
SSSRLNDWLDLYRVELDGVPAG
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcaccggatggatcgatttcgcccgcgatctgcgcaacgaagcgccgatc
gtcgacacgatgaccgatacgctcgcgcgccgcgggcccgatgcgcgcggcgtgtggctc
gacacgcacgccgcgctggggcaccggcggctgtcgatcatcgatcccgagcgcggcgcg
cagccgatgctcacgcccgagcgcgggccgcgcggcctgccgcgcgcggtcatctcgtat
gcgggcgaaacctacaacttccgcgaattgcgggccgagctgggcgcgctcggccaccgg
ttcgacacgcattgcgataccgaggtggtgctgcgcgcgtatctcgaatggggcgcggcg
ttcgtcgaccgtctcaacgggatgtattcgatcgcgatctgggataccgcgcgcgacgaa
ctgctgctcgtgcgcgaccggctcggcgtgaagccgctgttctactatccgacggcggac
ggcgtgatcttcggctcggagccgaaggcgatcctcgcgcatcccgacgtgcgcgcgcgc
acgtcgtcggaggggctttgcgatgcgctgctgttcctgcgcacgccggggcaggtgccg
ttctcggggatgcgcgaggtgaagcccggccatgtgctgcgcgtgcggcgcggcggcctc
gccgagcaacgctactgggcgctcgaagcgcgcccgcacaccgacgatctgccgacgacg
atcgcgacgatccgcgcgctgctcgacgacatcgtgtcgcgccagatgatctcggacgtg
ccgctgtgcgcgctgctgtcgggcggcgtcgattcgagcaccatcgccgcgctcgcgcag
aagcggcggcgcgcgagcggcggcggcgcgttgtcgacattctgcgtcgatttcaccggc
cacatgcgcaactttcgcgccgatccgattcgcccgacggccgatgcgccgttcgcgctc
gaagtcgcgcggcacatcggcagcgatcaccacacgatcgagctggaccaggccgggctg
ctcgatccgcaggtgcgcgaagcggtgctgcgcgcgtgggacttgccgttcaacttcgcc
gatctcgacgtgtcgctgcaccggctgttcgccgaggtccgcaagcacgccaccgtcgcg
ctatccggcgaggcggccgacgagatcttcggcggctacctgtggttctccgatccggcc
gcgcggcgtgcacacacgttcccgtggctgaagctgggcgcgcatcgcgggctcgatccg
cgcgcgctgtttcatcggtcgttcatcgatgcgctgcgactcggcgaatacgaagcacag
ctctaccgcgcggcgctcgccgaagtgccgcgcctcgacggcgagaacgcggaggaccgc
cgcacgcgcgagctgcattacctgacgctcacgcgctggctgccggtgctgctcgacaag
aaggaccggatggggatggcaagcggcctcgaggggcgcgtgccgttctgcgatcaccgg
ctcgtcgagtatgtgttcaacatcccgtgggcgatgaagacgttcagcggccaggagaag
gcgctgctgcgcgcggcggcggccgatctgctgcccgaatcggtgctgaaccgcaagaag
gccgcgtatccgtcgattcaggcgccgggctatgaccgcggcctgatcgagcgcctcaat
cgcgcgatcgcggccggccgcgcgccgctcgaaccgttcatcgacgccggcgcgctgcgc
ggcctgaccgagaagaccgccgccggcagcctttcggaattcgaacgaatcctgctggag
tcgagcagccggctcaacgactggctcgatctctatcgtgtcgagctcgacggcgtgccg
gcgggctga

DBGET integrated database retrieval system