KEGG   Burkholderia pseudomallei 668: BURPS668_A0602Help
Entry
BURPS668_A0602    CDS       T00481                                 

Gene name
bdhA
Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BURPS668_A0602 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BURPS668_A0602 (bdhA)
Enzymes [BR:bpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BURPS668_A0602 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:567542..568330
Genome map
AA seq 262 aa AA seqDB search
MTSNLNGKAAIVTGAASGIGKEIALELARAGAAVAIADLNQDGANAVAELIEQAGGRAIG
VAMDVTNEDAVNAGIDKVAQTFGSVDILVSNAGIQIVNPIENYAFADWKKMQAIHVDGAF
LTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNV
RSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGQTVDGVFTTVEDVAKTVLFL
SAFPSAALTGQSFVVSHGWFMQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgaacttgaacgggaaggcggccatcgtgacgggcgcggcgagcggcatcggc
aaggaaatcgcgctggagctcgcgcgcgcgggcgcggcggtggcgatcgccgatctgaac
caggacggcgcgaacgcggtggccgagctcatcgagcaggcgggcggccgggcgatcggc
gtggcgatggacgtgacgaacgaggacgcggtgaacgccggcatcgacaaggtcgcccag
acgttcggctcggtcgacattctcgtgtcgaacgcgggcatccagatcgtcaatccgatc
gagaactatgcgttcgccgactggaagaagatgcaggcgattcacgtcgacggcgcgttc
ctgacgacgaaggccgcgctcaagcacatgtacaaggacgatcgcggcggagtggtgatc
tacatgggctcggtgcattcgcacgaggcgtcgccgctgaagtcggcgtacgtgacggcc
aagcacgggctgctggggcttgcgcgcgtgctggcgaaggaaggcgcgaagcacaacgtg
cgctcgcatgtggtgtgcccgggcttcgtgcgcacgccgctcgtcgacaagcagattccg
gagcaggccaaggagctcggcatcagcgaagaggaggtggtgaagaaggtgatgctcggc
cagacggtggacggcgtgttcacgacggtcgaggacgtcgcgaagacggtgctgttcctg
tccgcgttcccgagcgcggcgctcaccggccagtcgttcgtcgtcagccacggctggttc
atgcagtaa

DBGET integrated database retrieval system