KEGG   Burkholderia pseudomallei 668: BURPS668_A0735Help
Entry
BURPS668_A0735    CDS       T00481                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BURPS668_A0735 (speB)
Enzymes [BR:bpd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BURPS668_A0735 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:699903..700865
Genome map
AA seq 320 aa AA seqDB search
MNETLYGDGAIRRPSIYGSSVENTYAGVLSFMRRNYTRDLGGVDVAVCGVPLDLATTFRS
GARLGPAAVRAASVQLAELRPYPWGFDPFDDLAVIDYGDCWFDAHNPLSIKPAIVEHART
ILQSGAAMLTLGGDHYITYPLLIAHTQRHGKPLSLIHFDAHCDTWADDAPDSLNHGTMFY
KAVNEGLIDPKTSVQVGIRTWNDDYLGIHVLDAAWVHEHGPRATAERIASIVGGRPAYLT
FDIDCLDPAFAPGTGTPVAGGLSSAQALAIVRGLGGVNLIGADVVEVAPAYDQSEITAIA
AAHVACDLLCLWRQRKTGAR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaacgctctatggcgacggcgcgatccgccgcccttccatctacggctcctcg
gtcgaaaacacttacgcgggcgtgctgtcgttcatgcggcgcaactacacgcgcgatctc
ggcggtgtcgacgtcgccgtctgcggcgtgccgctcgatctcgcgacgacgttccgctcc
ggcgcgcgcctgggccccgcggcggtacgcgcggcgagcgtgcagcttgccgaactgcgc
ccgtacccttgggggttcgatccgttcgacgatctcgcggtgatcgactatggcgactgc
tggttcgacgcgcacaatccgctgtcgatcaagcccgcgatcgtcgagcacgcgcgcacg
atcctgcaatcgggcgcggcgatgctgacgttgggcggcgatcactacatcacgtatccg
ctgctgatcgcgcacacacagcggcacggcaagccgctgtcgctgattcacttcgacgcg
cattgcgacacctgggccgacgacgcgcccgacagcctcaatcacggcacgatgttctac
aaggcggtcaacgaagggctgatcgatccgaagacgtcggtgcaggtcggcatccgtacg
tggaacgatgattacctcggcatccacgtgctcgacgccgcctgggtgcacgagcacggg
ccgcgcgcgacggccgagcgcatcgcgtcgatcgtcggcggccggccggcgtatctgacg
ttcgacatcgattgcctcgatcccgcgttcgcgccgggcacgggcacgccggtcgcgggc
gggctgtcgtccgcgcaggcgctcgcgatcgtgcgcggtctcggcggcgtgaacctgatc
ggtgcggacgtcgtcgaagtcgcgcccgcgtatgaccagagcgagatcaccgcgatcgcc
gccgcgcacgtcgcgtgcgatctgctgtgcctgtggcggcagcgcaagacgggcgcgcgc
tga

DBGET integrated database retrieval system