KEGG   Burkholderia pseudomallei 668: BURPS668_A0780Help
Entry
BURPS668_A0780    CDS       T00481                                 

Definition
phosphoenolpyruvate phosphomutase (EC:5.4.2.9)
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Metabolism of other amino acids; Phosphonate and phosphinate metabolism [PATH:bpd00440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(748968..750656)
Genome map
AA seq 562 aa AA seqDB search
MNAREPNFTESRSARLRRMLTSPSLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAQAGADAILIHSKLSRPDEILQFAREWSGRAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIQDSETLVNVEERVASVNEIFRLQDADEYSAAERIYLSSS
ARASSAALVLAASRGNGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKQGVNDITVVGGYR
ADAIDTSGVKLVVNERHAQTGELASLACAAERLTGDTIISYGDLLFRSYILRDLAESEAQ
FSVVVDSSQTQPSNQSVRDFAFCSAADDRGLFGQKAYLRRVSSDASEAAPHGRWIGLLNV
RGAGVARLKAMLGTLQARDDFDALDLPALLNALVDAGEQIEVQYVHGHWRGVNDLDDFRR
AGDFAHGQTPYAEQNAGSGSAR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacgcgaaccgaacttcaccgaatcgcgcagcgcgcggctgcggcggatgctg
acgagcccgtcgctcgaattcctgatggaggcgcacaacggcctgtccgcgcgcatcgtc
cgcgaggcgggcttcaagggcatctgggcgtcggggctcgcgatctccgcgcaattcggc
gtgcgcgacaacaacgaggcgagctggacacaggtggtcgacgtgctcgaattcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccggctcgtgagaaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagtttccgaaaaccaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatccggatttctcg
atcgtcgcgcgcgtcgaggcgctgatcgccggctggggcatggacgaggcgctgcgccgc
gcgaacgcgtatgcgcaggccggcgccgatgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctgcagttcgcgcgcgaatggagcggccgcgcgccgctcgtgatcgta
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggcgggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcgtccgcttccgcgatgcaggcggtcgcccgcgaa
atccaggacagcgaaacgctcgtcaacgtcgaggaacgcgtggcgagcgtcaacgagatc
ttccggctgcaggacgccgacgaatactcggccgccgagcgcatctacctgtcgtcgagc
gcgcgcgcgtcgagcgcggcgctcgtgctcgccgcgagccgcggcaacgggctcgaggcc
gtcaccgaggacaagccgaaggtgatgctgccggtcgccggcaagccgctgttgcgctgg
ctcgtcgacggcttcaagaagcagggcgtgaacgacatcacggtcgtcggcggctaccgc
gccgatgcgatcgacacgtccggcgtgaaactcgtcgtcaacgagcggcacgcgcaaacg
ggcgagctcgcgtcgctcgcctgcgcggccgagcgtctgacgggcgacaccatcatctcg
tacggcgatctgctgtttcgcagctacatcctgcgcgacctcgcggaaagcgaggcgcag
ttcagcgtcgtcgtcgattcgtcgcagacgcagccgtcgaaccagagcgtgcgcgatttc
gcattctgctcggccgccgacgaccgcgggctgttcggccagaaagcgtacctgcgccgc
gtgtcgagcgacgcgagcgaggccgcgccgcacgggcgctggatcggcttgctgaacgtg
cgcggcgcgggcgtcgcgcggctgaaggcgatgctcggcacgctgcaggcgcgcgacgat
ttcgatgcgctcgacctgccggcgctgctgaacgcgctcgtcgacgcgggcgagcagatc
gaagtgcagtacgtgcacggccattggcgcggcgtcaacgatctcgacgacttccgccgc
gcgggcgacttcgcgcacggccagacgccgtacgcggagcagaacgcgggcagcgggagc
gcacgatga

DBGET integrated database retrieval system