KEGG   Burkholderia pseudomallei 668: BURPS668_A1054Help
Entry
BURPS668_A1054    CDS       T00481                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bpd  Burkholderia pseudomallei 668
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(1017563..1018378)
Genome map
AA seq 271 aa AA seqDB search
MTGRTGILLIHGLGGTQYDLGSLHKAMRRAGGDTHMITLPGHGTRPEDLVDVRAEAWLDA
VTAQYRALEREYDTVHVAGMCMGALVALLLCRRVRHARGRLALLAAPMFIDGWSTPWYRS
LRHLLYRVPGVPARLRVDEDEPFGIKNPTIRAIVKKKFERQDNFHYPWVPLACIRQVDRL
RSWARAAAADTHCPTLVLHAREDELTSLRSADFLLKHLPDARGIVLENSYHMICADNDRD
EVARQVLTFFGFDPSHAMSPAMARRMGRADP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaccggccgaacgggcattctgctgatccacgggctcggcgggacgcagtacgatctc
ggctcgctgcacaaggcgatgcgccgggcgggcggcgacacgcacatgatcacgctgccg
gggcacggcacgcgtcccgaggatctcgtcgacgtgcgcgcggaagcatggctcgacgcg
gtcaccgcgcagtatcgcgcgctcgagcgcgagtacgacaccgtgcatgtcgcgggcatg
tgcatgggcgcgctcgtcgcgctgctgctgtgccggcgcgtgcggcacgcgcgcgggcgg
ctcgcgctgttggccgcgccgatgttcatcgacggctggtcgacgccctggtaccgatcg
ctgcgacatctgctgtaccgcgtgcccggcgtgccggcgcggctgcgcgtcgacgaggac
gagccgttcggcatcaagaacccgacgattcgcgcgatcgtgaagaagaagttcgagcgt
caggacaacttccactatccgtgggtgccgcttgcatgcatccgccaggtcgatcgcctg
cgaagctgggcgcgcgcggcggcggccgacacgcactgcccgacgctcgtgctgcatgcg
cgcgaggacgagctcacgagcctgcgctcggcggacttcctgctgaagcacctgcccgac
gcgcgcgggatcgtgctggagaacagctaccacatgatctgcgcggacaacgatcgcgac
gaagtcgcccggcaggtgctgacgtttttcggcttcgatccgtcgcatgcgatgagcccg
gcgatggcgcgccggatggggcgcgccgatccgtga

DBGET integrated database retrieval system