KEGG   Burkholderia pseudomallei 668: BURPS668_A1687Help
Entry
BURPS668_A1687    CDS       T00481                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bpd00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bpd00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:1637106..1638401
Genome map
AA seq 431 aa AA seqDB search
MTVPQQAFLRDAMRRLNMTREAFANRIGVSRRALDTWLLPDDSQESRGMPEIVERFVSEI
VERAPAADGYTQSVDSRQPLAQQFLFEGRPQLLSVDQFSRDSVEALFRVADVMQPIARRR
KISRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSSMAKGESIYDTSRV
MAGYVDALVIRHPEQGSVAEFARATNLPVINGGDGPGEHPSQALLDLYTIQREFSRLGKI
VDGACIALVGDLKYGRTVHSLVKLLALYRGLKFTLVSPPTLEMPAYIVDQISKNGHVVEE
THDLAAGLKGADVVYATRIQKERFTDESFEGYTPDFQINQARVDAACGPDTLIMHPLPRD
SRPGANDLSTDLNRDPRLAIFRQTDNGIPVRMAIFAVLLGVEHLVQHSMRDATWRPPTYL
GPEDAVFHGID
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttcctcagcaagcgttcctgcgcgacgcgatgcgccgcctgaacatgacccgc
gaagcgttcgcgaaccgcatcggcgtgagccggcgcgccctcgacacatggctgttgccg
gacgattcgcaggaatcgcgcggcatgcccgagatcgtcgagcgtttcgtctccgaaatc
gtcgagcgcgcgccggccgccgacggctatacgcaaagcgtagattctcgacagccgctt
gcgcagcagttcctgttcgaaggccggccgcagttgctgtcggtcgaccagttctcgcgc
gattccgtcgaagcgctgttccgggtcgccgacgtgatgcagccgatcgcgcgccgccgc
aagatctcgcgcgtgctcgagggcgcggtgctcggcaacctgttcttcgaggcgagcacg
cgcacgcgcgtgtcgttcggcgccgcgttctgcaggctcggcggctcggtgtgcgacacg
acgggcttcaccttctcgtcgatggccaagggcgaatcgatctacgatacgagccgcgtg
atggccggctacgtcgacgcgctcgtgatccgccatccggaacaaggctcggtcgccgaa
ttcgcgcgcgcgaccaacctgcccgtgatcaacggcggcgacggccccggcgagcatccg
agccaggcgctcctcgatctatatacgatccagcgcgaattctcgcgcctgggcaagatc
gtcgacggcgcgtgcatcgcgctcgtcggcgacctgaagtacggccgcacggtccactcg
ctcgtcaagctgctcgcgctgtatcgcgggctcaagttcacgctcgtctcgccgccgacg
ctcgagatgccggcctacatcgtcgatcagatctcgaagaacggtcacgtcgtcgaggaa
acgcacgacctcgcggcgggcctgaagggcgcggacgtcgtctacgcgacgcggatccag
aaggagcgcttcaccgacgaatcgttcgaaggctatacgcccgacttccagatcaatcag
gcacgggtcgacgcggcctgcggccccgacacgctgatcatgcacccgctgccgcgcgac
agccggcccggtgcgaacgatctgtcgaccgatctgaaccgcgacccgcgcctcgcgatc
ttccgccagaccgacaacgggattccggtgcgcatggcgatcttcgcggtgctgctcggc
gtcgagcatctcgtccaacactcgatgcgcgacgcgacgtggcgtccgcccacgtacctc
gggccggaggacgcggtgttccacgggatcgactaa

DBGET integrated database retrieval system