KEGG   Burkholderia pseudomallei 668: BURPS668_A1808Help
Entry
BURPS668_A1808    CDS       T00481                                 

Definition
putative oxidoreductase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BURPS668_A1808
Enzymes [BR:bpd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BURPS668_A1808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1766071..1767369)
Genome map
AA seq 432 aa AA seqDB search
MHVLVVGAGIAGLAAAWQLKRGGCDVTVVEAAERAGGRIRSAPFHGHVIECGAQFPSSGY
RHLMPLFGEAGLDAQLVKTSPWAAFEHRGRLFRVHARRPWTIPASGLLGWRDSVRVSRAR
AALLARVRALDPNRYAAFAEFDDADAAHWAERAFGRAAVDAIFAPMIHGLYFQPLRGASR
ALLAAVTGFDGADTLAVAGGWQTLPVALAARLDVRYGTRVDALSAHANGVDACVGDRALR
FDAAIVATPATVARRLWRGQTDAQRALLATGYARCAHVAFGLAPGWRAPARLRRVYGALL
SPHARRVAALTFERGRGIGDGQGEVVSAMLGHAGASALRYASDDEIARVALDDLRTLLPG
VAEAVVATRVQRWDEAEPLSPVGRARAIAAYRASIDARPRVLLAGDYMGSPWTDGAAETG
RWAARRLLDARA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtactcgtcgtcggagcaggaatcgccgggctcgccgccgcctggcaattgaaa
cggggcggatgcgacgtgaccgtcgtcgaggccgccgaacgcgcgggcggccgcattcgc
agcgcgccgttccacggccatgtgatcgaatgcggcgcgcagtttccgtcctccggctat
cggcacttgatgccgctcttcggcgaggcggggctcgatgcgcaactcgtgaagacctcg
ccgtgggcggcgttcgagcatcgcgggcggctttttcgcgtgcatgcgcggcggccgtgg
acgatccccgcgagcggcctgctcggctggcgcgacagcgtgcgcgtgagccgggcgcgc
gccgcgctgctcgcgcgggttcgcgcgctcgatccgaaccgctatgcggcgttcgcggaa
ttcgacgacgccgacgcggcgcactgggcggaacgcgcgttcgggcgcgcggcggtcgac
gcgatcttcgcgccgatgattcacgggctgtatttccagccgctgcgcggcgcgtcacgc
gcgctgctcgcggccgtcaccggcttcgacggcgcggatacgctcgcggtcgcgggcggc
tggcagacgctgcccgtcgcgctcgcggcccggctcgacgtgcgctacggcacgcgggtc
gatgcgctgtcggcgcacgcgaacggcgtcgacgcgtgcgtcggcgatcgcgcgctgcgt
ttcgacgcggcgatcgtcgcgacgcccgcgaccgtcgcgcgccgcctctggcgcgggcag
accgacgcgcagcgcgcgctgctcgcgacgggctatgcacgctgcgcgcacgtcgcgttc
ggcctcgcgccgggctggcgcgcgcccgcgcggctgcgccgcgtgtacggcgcgctgctg
tcgccgcacgcgcgacgcgtcgcggcgctcacgttcgagcgcgggcgcgggatcggcgac
gggcagggcgaggtcgtatcggcgatgctcgggcatgcgggcgcgagcgcgctgcgctat
gcatcggacgacgagatcgcgcgcgtcgcgctcgacgacctgcgcacgctgttgccgggc
gtcgccgaggcggtcgtcgcgacgcgcgtgcagcgctgggacgaggccgagccgctgtcg
cccgtcggccgcgcgcgcgcgatcgccgcataccgcgcgagcatcgacgcgcgcccgcgc
gtgctgctcgcgggcgactacatgggctcgccgtggaccgacggcgcggcggagacgggc
agatgggcggcgcgcaggctgctcgacgcgcgcgcatga

DBGET integrated database retrieval system