KEGG   Burkholderia pseudomallei 668: BURPS668_A2146Help
Entry
BURPS668_A2146    CDS       T00481                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BURPS668_A2146
Enzymes [BR:bpd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BURPS668_A2146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:2084373..2085005
Genome map
AA seq 210 aa AA seqDB search
MIDTQYNGACDVHHHSPAEIRRIRQFDPAAFEMAVGSLLMACGIEIDAAHTSRTAQRVRE
LWQKRLLDGYDVDPAEALGMGFDDRKEDMVIIRSIAVHGVCPHHLLPFRGVAHVAYLPGG
RLHGFGRIARMIDAISHRFTYQEWITNEIATALVTHGKARGAACLIEAEQLCLLMGENRR
GDERVITQCYVGEFDHNAQARNEFLRAINR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgattgacacccaatacaatggcgcatgcgatgtccaccaccattctccggccgaaatt
cgacgcatccgccagttcgatcccgccgccttcgaaatggcggtcggtagcttgctcatg
gcctgtggtatcgagatagacgccgcacataccagccgcacggcgcaacgtgtgcgggaa
ctctggcagaagcgcttgcttgacggctacgatgttgatcctgccgaagcgctgggtatg
ggtttcgatgatcgaaaggaagatatggtcatcatccgcagtatcgctgtccatggtgtt
tgtccgcatcacttgttgccatttcgcggcgtagcacacgtggcctatctgccgggaggg
cgactgcatggcttcgggcgcatcgcccgtatgatcgatgcgatcagccatcgatttaca
taccaggagtggattacaaacgagattgcgacagcccttgtcactcatggaaaagcacgc
ggagcagcttgcctgatcgaagccgaacaactgtgcttgctcatgggcgaaaatcgccgc
ggcgacgagcgcgtaattacgcaatgctacgtgggcgaatttgaccataacgcccaggcg
cgcaacgagtttcttcgcgccatcaatcgatag

DBGET integrated database retrieval system