KEGG   Burkholderia pseudomallei 668: BURPS668_A2231Help
Entry
BURPS668_A2231    CDS       T00481                                 

Definition
(GenBank) glycosyl hydrolase, family 8
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
bpd  Burkholderia pseudomallei 668
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:complement(2163852..2165372)
Genome map
AA seq 506 aa AA seqDB search
MARQAGRDEGVGRIGREAGDAREAAGAGEACGRRHARADAWARRASRASRGWRTFWRGRG
GVRAVVASVVASFSVMAFAAATLPVSWRVAAAAERTRSGGERAGGLRDTAGLIEISAAAP
ASTPIPAAPRRFAQPFAQPARAFAAASACAPSWPRWDRFKRDFVSADGRVIDVGSADERT
VSEGQAYGLFFALVANDRAAFDALLRWTEDNLAQGDLSARLPAWLWGRAADGAWRVLDAN
AASDADLWLAYALLEAGRLWRERSYTARGALLAKRVLDEETATLPGLGLVLLPGPTGFRP
ARDAWRLNPSYSPPQAIRGIGAHVPDDARWARLAAGVGRVLTDSAPRGFAPDWALYRAGR
GFEPDAETHAASAYNAIRVYLWAGMLDAGDPLARPLVAHFAPFAEHVAAHGAPPEAVDAT
TGTAAPRDGNAGFSAAAVPFLEARGERASADAQLARVARLERETASGYYANVLTLFGLGW
RDGRYRFAADGTLRVRWSEPCSTPAR
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggcaagcggggcgagacgaaggcgtcgggcgcatcgggcgtgaagcgggcgac
gcgcgcgaggcggccggggcgggcgaggcgtgcgggaggcgccacgcgcgggccgacgcg
tgggcgcggcgggcgtcgcgagcatcgcgcgggtggcgcacgttttggcgcgggcgcggg
ggcgtgcgcgccgtcgtggcgagcgtcgtggcgagcttctcggtgatggcgttcgcggcg
gcgacgttgccggtgtcgtggcgcgtcgccgcggcggcggagcgtacgcgaagcggcggc
gaacgcgcgggcgggctgcgcgacacggcgggcttgatcgagatctcggcggcggcgccg
gcctcgacgccgatcccggcggcgccgcggcggttcgcgcagccgttcgcgcagcccgcc
cgcgcgttcgccgccgcgagcgcctgcgcgccgtcctggccgcgctgggaccgtttcaag
cgtgacttcgtatcggccgacggccgcgtgatcgacgtcggctcggccgacgagcggacc
gtatccgaggggcaggcgtacggccttttcttcgcgctcgtcgcgaacgaccgcgcggcg
ttcgacgcgctgctgcgctggaccgaggacaatctcgcgcagggcgatctgagcgcgcgt
ctgcccgcgtggctgtggggccgcgcggccgacggcgcgtggcgcgtgctcgatgcgaac
gccgcgtccgacgccgatctgtggcttgcgtacgcgctgctcgaagcggggcgcttgtgg
cgcgagcgcagctacacggcgcgcggcgcgttgctcgcgaagcgcgtgctcgacgaggag
accgcgacgctgccggggctcggtctcgtgctgctgccgggcccgacgggttttcggccg
gcgcgcgacgcgtggcggctgaatccgagctattcgccgccgcaggcgattcgcggaatc
ggcgcgcatgtgcccgacgacgcgcgctgggcgcggctcgcggcgggcgtcggccgcgtg
ctgaccgacagcgcgccgcgcggcttcgcgccggactgggcgctgtatcgcgcgggccgc
ggcttcgagccggacgccgaaacgcatgcggcgagcgcgtacaacgcgattcgcgtctat
ctgtgggcgggcatgctcgatgcgggcgatccgctggcgcggccgctcgtcgcgcatttc
gcgccgttcgccgagcatgtcgccgcgcatggcgcgccgccggaggcggtcgatgcgacg
acgggcacggccgccccgcgcgacggcaatgccgggttttccgcggcggccgtgccgttt
ctcgaggcgcgcggcgagcgggcgagcgccgacgcgcagctcgcgcgcgtcgcgcggctc
gagcgcgagacggcgagcggctattacgcgaacgtgctgacgctgttcgggctcggctgg
cgcgacgggcgctaccggttcgcggccgacggcacgctgcgggtgcgatggagcgagccg
tgctcgacgcccgcgcgttga

DBGET integrated database retrieval system