KEGG   Burkholderia pseudomallei 668: BURPS668_A2335Help
Entry
BURPS668_A2335    CDS       T00481                                 

Definition
Phage-like lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bpd  Burkholderia pseudomallei 668
Brite
Enzymes [BR:bpd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     BURPS668_A2335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(2273582..2274394)
Genome map
AA seq 270 aa AA seqDB search
MGLSDLFGALARLFGMNPAPVVDVPTSSIESTKTDIQDPTAPLPAAPDTSFAMGGAEIAP
AVPKNVPSDADDDAWLALCRPLSQHFESCYLTAYPDPASPLGKALQARGLWYKVLGGAPI
PSDPALRALSGAPWTCGWGSTGPDVREGTVWTQATADARHDANLRAAAALIDQAARVQLS
AQQKAAMTSIVNNVGAGRARRAGDPGRDGIITLASGQPSTLLRHLNIGDFAGAADQFPAW
NRAGGVVQPGLVRRRAAERDLFLTGHWSAS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggggctcagtgatctcttcggcgcgctcgcgcggctgttcggcatgaacccggcgccg
gtcgtcgacgtgccgacgtcctcgatcgagtcgacgaaaacggacatccaggatcctact
gcaccacttccagccgctcctgatacgagtttcgcgatgggtggggcggaaatcgcgccg
gctgtaccgaaaaacgttccatccgatgcagatgacgacgcgtggctcgcgctctgccgt
ccgctgtcgcagcacttcgaaagctgctacctgaccgcctatcctgacccggcgtcgcca
ctcggcaaagcactgcaggcgcgcggcctctggtacaaggtgctcggcggcgcgccgatc
ccgagcgaccccgcgctgcgcgcgctgagtggcgcgccgtggacgtgcggatggggctcg
accgggccggatgtgcgcgagggtacggtctggacgcaggcgaccgccgacgcgcgccac
gacgcgaacctgcgcgccgcggcagcgctcatcgaccaggccgcgcgcgtgcaactgtcg
gcgcagcagaaggcggccatgacgagcatcgtgaacaacgttggggccggccgcgcgcgg
cgagcaggcgatccagggcgcgatggcatcatcacgctcgccagcggccagccatcgacg
ctcttgcggcatctgaacatcggcgacttcgctggcgcggccgatcagtttcccgcgtgg
aaccgcgcgggcggcgtcgtgcagcccggtctcgtgcgccggcgcgcagctgagcgcgat
ctcttcctcaccggccattggagcgcgtcatga

DBGET integrated database retrieval system