KEGG   Burkholderia pseudomallei 668: BURPS668_A2422Help
Entry
BURPS668_A2422    CDS       T00481                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BURPS668_A2422 (galU)
   00052 Galactose metabolism
    BURPS668_A2422 (galU)
   00500 Starch and sucrose metabolism
    BURPS668_A2422 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BURPS668_A2422 (galU)
Enzymes [BR:bpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BURPS668_A2422 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(2341306..2342193)
Genome map
AA seq 295 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRS
KRAIEDHFDKSFEIESELEARGKEKLLELVRGIKPSHVDCFYVRQPAALGLGHAVLCAEK
LVHGEPFAVILADDLLHGDQPVLKQLVDVFNHYHSSVIGVETIEREDSRSYGIVEGREWE
EDIIKLSGIIEKPAPEHAPSNLGVVGRYVLMPSIFEHLRKIKPGAGGELQLTDAVQSLLT
EEQVLAYRYYGTRFDCGSKLGYLKATVELALRHPEVGREFEAYLRNCLPALAAVA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaagccgtgttccccgttgccggtctcggcacacggtttttgccc
gccacgaaggcgagtccgaaggaaatgctgcccgtggtcgacaagccgctgatccagtac
gcggtcgaagaggcgatcaatgcgggcatcaccgagatgatcttcgtgacgggccgcagc
aagcgcgcgatcgaagatcacttcgacaaatcgttcgagatcgaatccgagctcgaggcg
cgcggcaaggaaaagctgctcgaactcgtgcgcggcatcaagccgagccatgtcgactgc
ttctacgtgcgccagccggccgcgctcggcctcggccacgcggtgctctgcgcggagaag
ctcgtgcacggcgagccgttcgcggtgatcctcgccgacgacctgctgcacggcgaccag
ccggtgctcaagcagctcgtcgacgtcttcaaccactatcacagctcggtgatcggcgtc
gagacgatcgagcgcgaggacagccgctcgtacggcatcgtcgaaggccgcgagtgggaa
gaagacatcatcaagctgtcgggcatcatcgagaagccggcgcccgagcatgcgccgtcg
aacctcggcgtcgtcggccgctacgtgctgatgccgagcatcttcgagcatctgcgcaag
atcaagccgggcgcgggcggcgaactgcaactgacggacgcggtgcagtcgctgctgacc
gaggagcaggtgctcgcgtaccgctactacggcacccgtttcgactgcggcagcaagctc
ggctatctgaaggcgacggtcgagctcgcgctgcggcatccggaagtgggccgcgaattc
gaggcgtacctgcgcaactgcctgccggcgctcgccgcggttgcttag

DBGET integrated database retrieval system