KEGG   Burkholderia pseudomallei 668: BURPS668_A2682Help
Entry
BURPS668_A2682    CDS       T00481                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BURPS668_A2682 (cheB)
Enzymes [BR:bpd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BURPS668_A2682 (cheB)
Two-component system [BR:bpd02022]
 CheA family
  WspE-WspRF
   BURPS668_A2682 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(2567409..2568437)
Genome map
AA seq 342 aa AA seqDB search
MNIGIVNDLPLAVEALRRTIALRPEHRVLWVATDGAQALDFCVAQPPDLVLMDLVMPRID
GVSATRSIMERSPCAILIVTANVGANASYVYEAMGAGALDAVDTPTLEQGGSADPSQPLL
AKIDQIGRLLATRMPLAAPAAAAPAPQGALPPLVAIGASAGGPTALTALLRRLPDDFPAA
LVIVQHVDQAFAIGMAQWLDGYSPLPVRIARQGSVPQAGEVLLAATNDHLHLTSRGVLAY
TRRPEETPYRPSVDVFFHSVVDHWKGEAIGVLLTGMGRDGALGLKAMRTKGHYTIAQDEA
TSAVYGMPKAAAAIGAASAVLPLERIADQLISLVQRNRQRWR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcggcatcgtcaacgacttgccgctcgccgtcgaggcgctgcgccgcacgatc
gcgctgcggcccgagcaccgcgtgctgtgggtcgcgacggacggcgcgcaggcgctcgac
ttctgcgtcgcgcagccgccggacctcgtcctgatggatctcgtgatgccgcgcatcgac
ggcgtatcggcgacgcgcagcatcatggagcgctcgccgtgcgcgatcctcatcgtcacc
gcgaacgtcggcgcgaacgcgtcgtacgtctacgaggcgatgggcgcgggcgcgctcgac
gcggtcgacacgccgacgctcgagcagggcggcagcgccgatccgtcgcagccgctgctc
gcgaagatcgaccagatcggccggctgctcgcgacgcgcatgccgctcgccgcgcccgcc
gccgccgcgcccgcgccgcagggcgcgttgccgccgctcgtcgcgatcggcgcgtcggcg
ggcgggccgaccgcgctgaccgcgctgctgcggcggctgccggacgattttccggcggcg
ctcgtgatcgtccagcatgtcgaccaggcgttcgcgatcggcatggcgcagtggctcgac
ggctattcgccgttgccggtgcgcatcgcgcggcagggcagcgtgccgcaggcgggcgag
gtgctgctcgcggcgaccaacgatcacctgcatctgacgtcgcgcggggtgctcgcgtac
acgcggcgtccggaagagacgccgtaccggccgtcggtcgacgtgttctttcacagcgtc
gtcgatcactggaagggcgaggcgatcggcgtgctgctcacgggcatggggcgcgacggc
gcgctcggcctgaaggcgatgcgcacgaaggggcattacacgatcgcgcaggacgaagcg
acgagcgcggtgtacgggatgccgaaggccgcggccgcgatcggcgcggcgagcgcggtg
ctgccgctcgagcggatcgccgatcagttgatctcgctcgttcagcgcaacaggcagcgc
tggcgctga

DBGET integrated database retrieval system