KEGG   Burkholderia pseudomallei 668: BURPS668_A2801Help
Entry
BURPS668_A2801    CDS       T00481                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BURPS668_A2801 (pfk)
   01230 Biosynthesis of amino acids
    BURPS668_A2801 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS668_A2801 (pfk)
   00030 Pentose phosphate pathway
    BURPS668_A2801 (pfk)
   00051 Fructose and mannose metabolism
    BURPS668_A2801 (pfk)
   00052 Galactose metabolism
    BURPS668_A2801 (pfk)
  Energy metabolism
   00680 Methane metabolism
    BURPS668_A2801 (pfk)
Enzymes [BR:bpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BURPS668_A2801 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(2671187..2672515)
Genome map
AA seq 442 aa AA seqDB search
MRGACASRAMFDTGGKRQAASGKRQAASGKRQAASGKRQAASGKRQAASGKRQAASSKQQ
AASSKQQAASSKQQAASSSRPAPVLMVRRRIERKHCGACPPRSTREPRTRASRCVVFPSR
IPTLKPNVTMPEIVTLTPNPAIDVATCVERVTDTRKLRCGPARRDPGGGGINVARVLTRL
GADCSAVYLAGGGTGLALRGLLADEGVRAHGIDIAGETRENFSVLETSTGREFRFVLPGP
ALAAHEWPRCVEALGRLADASRYLVMSGSLPPGMPDDCYARLARRASARGVRTVVDTSGP
ALAAALDAGVYLVKPSLGELRALTGLPLEDDGARLAAARAIVAGGRAQIVALTLGDAGAL
VVSRDDAVRLPGVKVAVRSAIGAGDSFVAGLVAALNRGANVADAARHALAAASASLLSTG
TALGTKEDIARIYRELPGTIDA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcggcgcttgcgcgtcgcgcgcgatgttcgatactggcggcaagcggcaagcggca
agcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcg
gcaagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcagcaagcagcaa
gcagcaagcagcaagcagcaagcagcaagcagcaagcagcaagcagcaagcagcagtcga
cctgcgccggtgctgatggttcgacgccgaatcgaacgcaagcattgcggcgcgtgcccg
ccgcgcagcacccgcgagccgcgcacccgagccagccgctgcgttgtctttccgtcgcga
attcccacgttgaaaccgaacgtcacgatgcccgaaatcgtcaccctcacgccgaatccc
gccatcgacgtcgcgacgtgcgtcgagcgagtcaccgacacccgcaagctgcgctgcggc
cccgcacgacgcgatccgggcggcggcggaatcaatgtcgcacgcgtgctgacgcgcctc
ggcgccgattgttcggccgtctacctggcgggcggcggcaccggcctcgcgctgcgcggc
ctgctcgccgacgaaggcgtgcgggcgcatggcatcgacatcgccggcgagacgcgcgaa
aacttttcggtgctcgaaacgtcgacgggccgcgaattccgcttcgtgttgcccgggccg
gcgctcgcggcgcacgaatggccgcgctgcgtcgaagcgctcgggcggctcgccgacgcg
tcgcgctatctagtgatgagcggcagcctgccgcccggcatgccggacgattgctacgcc
cggctcgcgcggcgcgcgagcgcgcgcggcgtgcgcacggtcgtcgatacgtcggggccg
gcgctcgccgccgcgctcgatgcgggcgtctatctggtgaagccgagcctcggcgagttg
cgcgcgctgaccggcctgccgctcgaagacgacggcgcgcgccttgccgctgcgcgcgcg
atcgtcgccggcgggcgcgcgcagatcgtcgcgctgacgctcggcgacgcgggcgcgctc
gtcgtgtcgcgcgacgatgcggtgcgtctgccgggcgtgaaggtggcggtgcgcagcgcg
atcggcgcgggcgacagcttcgtcgcggggctcgtcgccgcgctcaatcgcggcgcgaac
gtcgccgacgcggcgcgccatgcgctcgccgccgcgtcggcgtcgctgctgagcacgggc
accgcgctgggcacgaaggaagacatcgcgcggatctatcgcgaactgccggggacgatc
gacgcgtga

DBGET integrated database retrieval system