KEGG   Burkholderia pseudomallei 668: BURPS668_A2806Help
Entry
BURPS668_A2806    CDS       T00481                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BURPS668_A2806 (deoA)
Enzymes [BR:bpd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     BURPS668_A2806 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(2674568..2675890)
Genome map
AA seq 440 aa AA seqDB search
MTFLPQEFIRKVRDRAPLDTADVARFVQGVTAGDVTEGQIAAFAMAVYFNELPLSARIAL
TLAQRDSGDVLDWRGARLNGPVVDKHSTGGVGDLTSLVIGPMVAACGGYVPMISGRGLGH
TGGTLDKLEAIPGYDVAPSVDMLRRVVRDAGLAIVGQTAQLAPADKRIYAVRDVTATVES
ISLITASILSKKLAAGVGALAMDVKVGSGAFMPSAEQSAELARSIVDVGNGAGMRTAATL
TDMNQALAPCAGNAIEVRCAIDFLTGAARPARLEAVSFALAAQMLTMGGLAADAHDARRR
LRAALESGAAAERFARMVAALGGPADLVERPERHLPRAAAAAPVAAARAGWIERIDARAL
GLAVVGLGGGRAKIGDTLDYSVGLSALAELGERVEAGQPLATVHARDADSAAQAADAVRR
AYRIGAEPPAQTRVVHAVIE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcctgccgcaggaattcatccgcaaggtgcgcgaccgcgcgccgctcgacacg
gccgacgtcgcgcgtttcgtccaaggcgtgacggcgggcgacgtgaccgaaggccagatc
gccgcgttcgcgatggcggtctatttcaacgagctgccgctgtccgcgcgcatcgcgctg
acgctcgcgcagcgcgattccggcgatgtgctcgactggcgcggcgcgcgcctgaacggg
ccggtggtcgacaagcactcgacgggcggcgtcggcgatctgacctcgctcgtgatcggg
ccgatggtggccgcgtgcggcggctacgtgccgatgatctcgggccgcggcctcggccac
acgggcggcacgctcgacaagctcgaggcgattcccggttacgatgtcgcgccgtccgtc
gacatgctgcgccgcgtcgtgcgcgacgcgggccttgcgatcgtcggccagaccgcgcag
ctcgcgcccgccgacaagcggatctatgcggtgcgcgacgtgacggcgaccgtcgaatcg
atctcgctgatcaccgcgtcgatcctgtcgaagaagctcgcggcgggcgtcggcgcgctc
gcgatggacgtgaaggtcggctccggcgcgttcatgccgagcgcggagcaatcggccgaa
ctcgcgcgcagcatcgtcgacgtcggcaacggcgcggggatgaggacggccgcgacgctc
accgacatgaaccaggcgctcgcgccatgcgcgggcaacgcgatcgaggtgcgctgcgcg
atcgatttcctgacgggcgcggcgcgccccgcacggctcgaagcggtcagcttcgcgctc
gccgcgcagatgctgacgatgggcgggcttgccgcggacgcgcacgatgcgcgccgccgg
ttgcgcgcggcgctcgaatcgggcgcggccgcggagcggttcgcgcggatggtcgcggcg
ctcggcgggcccgccgatctggtcgagcggcccgagcggcatctgccgcgcgcggccgcc
gccgcccccgtggccgccgcgcgcgccggctggatcgagcggatcgacgcgcgcgcgctc
ggcctggcggtcgtcggcctgggcggcgggcgcgcgaagatcggcgacacgctcgattac
tcggtcggactgtccgcgctcgcggagctgggcgagcgcgtcgaggcgggccagccgctc
gcgaccgttcacgcgcgcgacgccgattcggccgcgcaggcggccgacgcggtgcggcgc
gcctaccggatcggcgcggagccgccggcgcagacgcgcgtcgttcatgccgtgatcgaa
tga

DBGET integrated database retrieval system