KEGG   Burkholderia pseudomallei 668: BURPS668_A2999Help
Entry
BURPS668_A2999    CDS       T00481                                 

Definition
acetyltransferase
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bpd00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bpd00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bpd00640]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(2850644..2853055)
Genome map
AA seq 803 aa AA seqDB search
MAARRSPSLNPFSGVAVTVRNLDALFHPTAVAVVGASPRPGSVGAMVWACVLDGRFGGAI
WPVNPKYGELNGHKVYPYVDQLPSAPSVALICTPPATWPGIVRKLGGLGVRAAIIVGETR
SGADRAALERALAAAKPYLLRVVGPGSLGVVSPALGAHFGAPACIVKAGGVAWVSQSNAL
TNAVLGWAHARGLGFSHAVALGGEADVDAADVLDYLASDAETRAILLELDTVKSARKFMS
AARAAARNKPVLALRAGRGDSGDLLYTAAFQRAGMVRVDALDDLLDEIEALGVGRAAATS
GGVTLVTSDRGVAKLAVDALAAAGETLAQWPRAAVDEVGGALPAGIVAGNPLLLGDDARP
EYFGAALKALAQHPPTGTVFVVHATSHSAPAVDVARVLIESRKFARRGMLACFFGGVDAA
TRDALHVHGIPVHTTPQRLARAHARLVDYQLGRELLMQTPEGTPPQPAASISAARHTARA
ALAQGRDGFEGDAALEWLAGFGIERATDADVDMGDTIVDITVGMYDDPNFGPVFRYSVPP
ADGVSAPFVVYGLPPFNTVLARAVVARSPYAHRAPPEPLLQALTALSQAVCDVREIVEMS
LVLRVRPTRVVALGPHIRLATGRSRLAIVPYPRYLEQQLDWRGERITVRPIRPEDEAAHR
ELLSAMTPDDLRMRFFGAIRNFDHSQIARMTQIDYDREMALIATLDDADGRAHTLGAVRA
VTDPDNEATEFAIAVRPDQKGKGLGRMLMTRIIDYARSRGTAWMIGEALRENTAMISLAK
DSGFAVSSTEEPGVVAFRLKLQP
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcgcgtcgatcgccgtcgctcaatcctttcagcggagttgccgtgaccgttcgc
aatctcgatgcgttgttccatccgacagccgttgccgtcgtcggcgcttcgccgcgcccg
ggcagcgtcggcgcgatggtgtgggcgtgcgtgctcgacggccggttcggcggcgcgatc
tggcctgtcaacccgaagtacggcgaactgaacggccacaaggtttatccctatgtcgac
cagctgccgagcgcgccgtcggtcgcgctcatatgcacgccgcccgcgacgtggcccggc
atcgtgcgcaagctgggcggcctgggcgtgcgtgcggcgatcatcgtcggcgagactcgt
tcgggcgcagaccgggccgcgctggaacgggcgcttgccgcggcgaagccatatctgctg
cgagtcgtcgggccgggcagcctgggcgtggtgtcgcccgcgctgggcgcgcatttcggc
gcgccggcgtgcatcgtcaaggcgggtggcgtcgcatgggtgtcgcaatcgaatgcgctg
acgaacgcggtgctcggctgggcgcatgcgcgcgggctcggtttctcgcatgcggtcgca
ctcggcggcgaggcggatgtcgacgcggccgacgtgctcgactacctggcgagcgatgcc
gagacacgcgcgatcctgctcgagctcgacacggtgaaatcggcgcgcaagttcatgtcg
gcggcgcgcgccgcggcgcgcaacaagccggtgcttgcgttgcgcgcggggcgcggcgat
tcgggcgacctgctttacacggccgcgtttcagcgtgcggggatggtgcgcgtcgacgcg
ctcgacgatcttctcgacgagatcgaggcgctcggcgtcggccgtgccgcggcgacgagc
ggcggggtgacgctcgtcacgagcgacaggggcgtcgcgaagcttgccgtcgacgcactc
gcggcggcgggggaaacgctggcgcaatggccgcgggcggccgtcgacgaagtcggcggc
gcgctgcccgcgggcatcgtcgccggcaatccgttgctgctcggcgacgacgcgcggccc
gaatatttcggcgcggcgctgaaggcgctcgcgcagcatccgccgacaggcaccgtgttc
gtggttcatgcgacgtcgcatagcgcgcctgccgtcgacgtcgcacgtgtgctgatcgaa
tcgcgcaagttcgcgcgtcgcggcatgctcgcgtgcttcttcggcggcgtcgacgccgcg
acgcgcgacgcgctgcacgtgcacggcatccccgtgcacacgacgccgcagcgtctcgcg
cgcgcgcatgcgcgccttgtcgattatcaattgggccgggagctgttgatgcagacgccg
gagggcacgccgccgcaaccggcggcgtcgatctcggccgcgcggcacacggcgcgcgcg
gcgctcgcgcaggggcgcgacgggttcgaaggcgacgcggcgctcgaatggctggcgggt
ttcggcatcgagcgcgcgaccgacgcggacgtcgacatgggcgatacgatcgtcgacatc
acggtcgggatgtacgacgacccgaacttcgggccggtattccgctattcggtgccgccg
gcggatggcgtgtccgcgccgttcgtcgtctacgggctgccgcctttcaataccgtgctc
gcgcgcgcggtcgtcgcgcgatcgccgtatgcgcatcgcgcgccgcccgagccgcttctg
caggcactgaccgcgctttcgcaggcggtgtgcgatgtgcgcgaaatcgtcgagatgtcg
ctcgtgctgcgcgtgcggcccacacgcgtggtcgcgttggggccgcacatcaggctcgcg
acggggcgcagccggctcgcgatcgtgccatatccgcgctatctcgagcagcagctcgac
tggcgcggagaacgcatcacggtgcgtccgattcgccccgaggacgaggccgcgcatcgc
gagctgctgagcgcgatgacgccggacgatctgcgaatgcgcttcttcggtgcgatacgc
aacttcgaccattcgcagatcgcgcggatgacgcagatcgattacgaccgcgagatggcg
ctgatcgcgacgctcgacgatgccgacggccgcgcgcatacgctcggcgcggtgcgcgcg
gtgaccgatccggacaacgaagcgacggagttcgcgatcgcggtgcggcctgaccaaaag
ggcaaggggctcggacggatgttgatgacgcgcatcatcgactacgcgcgctcgcgcgga
acggcgtggatgatcggcgaggcactgcgcgagaacacggcgatgatctcgctcgcgaag
gacagcggttttgcggtgtcgtcgaccgaggagcctggggtggtggcgttccggctgaag
ctgcagccgtga

DBGET integrated database retrieval system