KEGG   Burkholderia pseudomallei 668: BURPS668_A2999Help
Entry
BURPS668_A2999    CDS       T00481                                 

Definition
(GenBank) acetyltransferase, GNAT family
Organism
bpd  Burkholderia pseudomallei 668
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:complement(2850644..2853055)
Genome map
AA seq 803 aa AA seqDB search
MAARRSPSLNPFSGVAVTVRNLDALFHPTAVAVVGASPRPGSVGAMVWACVLDGRFGGAI
WPVNPKYGELNGHKVYPYVDQLPSAPSVALICTPPATWPGIVRKLGGLGVRAAIIVGETR
SGADRAALERALAAAKPYLLRVVGPGSLGVVSPALGAHFGAPACIVKAGGVAWVSQSNAL
TNAVLGWAHARGLGFSHAVALGGEADVDAADVLDYLASDAETRAILLELDTVKSARKFMS
AARAAARNKPVLALRAGRGDSGDLLYTAAFQRAGMVRVDALDDLLDEIEALGVGRAAATS
GGVTLVTSDRGVAKLAVDALAAAGETLAQWPRAAVDEVGGALPAGIVAGNPLLLGDDARP
EYFGAALKALAQHPPTGTVFVVHATSHSAPAVDVARVLIESRKFARRGMLACFFGGVDAA
TRDALHVHGIPVHTTPQRLARAHARLVDYQLGRELLMQTPEGTPPQPAASISAARHTARA
ALAQGRDGFEGDAALEWLAGFGIERATDADVDMGDTIVDITVGMYDDPNFGPVFRYSVPP
ADGVSAPFVVYGLPPFNTVLARAVVARSPYAHRAPPEPLLQALTALSQAVCDVREIVEMS
LVLRVRPTRVVALGPHIRLATGRSRLAIVPYPRYLEQQLDWRGERITVRPIRPEDEAAHR
ELLSAMTPDDLRMRFFGAIRNFDHSQIARMTQIDYDREMALIATLDDADGRAHTLGAVRA
VTDPDNEATEFAIAVRPDQKGKGLGRMLMTRIIDYARSRGTAWMIGEALRENTAMISLAK
DSGFAVSSTEEPGVVAFRLKLQP
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcgcgtcgatcgccgtcgctcaatcctttcagcggagttgccgtgaccgttcgc
aatctcgatgcgttgttccatccgacagccgttgccgtcgtcggcgcttcgccgcgcccg
ggcagcgtcggcgcgatggtgtgggcgtgcgtgctcgacggccggttcggcggcgcgatc
tggcctgtcaacccgaagtacggcgaactgaacggccacaaggtttatccctatgtcgac
cagctgccgagcgcgccgtcggtcgcgctcatatgcacgccgcccgcgacgtggcccggc
atcgtgcgcaagctgggcggcctgggcgtgcgtgcggcgatcatcgtcggcgagactcgt
tcgggcgcagaccgggccgcgctggaacgggcgcttgccgcggcgaagccatatctgctg
cgagtcgtcgggccgggcagcctgggcgtggtgtcgcccgcgctgggcgcgcatttcggc
gcgccggcgtgcatcgtcaaggcgggtggcgtcgcatgggtgtcgcaatcgaatgcgctg
acgaacgcggtgctcggctgggcgcatgcgcgcgggctcggtttctcgcatgcggtcgca
ctcggcggcgaggcggatgtcgacgcggccgacgtgctcgactacctggcgagcgatgcc
gagacacgcgcgatcctgctcgagctcgacacggtgaaatcggcgcgcaagttcatgtcg
gcggcgcgcgccgcggcgcgcaacaagccggtgcttgcgttgcgcgcggggcgcggcgat
tcgggcgacctgctttacacggccgcgtttcagcgtgcggggatggtgcgcgtcgacgcg
ctcgacgatcttctcgacgagatcgaggcgctcggcgtcggccgtgccgcggcgacgagc
ggcggggtgacgctcgtcacgagcgacaggggcgtcgcgaagcttgccgtcgacgcactc
gcggcggcgggggaaacgctggcgcaatggccgcgggcggccgtcgacgaagtcggcggc
gcgctgcccgcgggcatcgtcgccggcaatccgttgctgctcggcgacgacgcgcggccc
gaatatttcggcgcggcgctgaaggcgctcgcgcagcatccgccgacaggcaccgtgttc
gtggttcatgcgacgtcgcatagcgcgcctgccgtcgacgtcgcacgtgtgctgatcgaa
tcgcgcaagttcgcgcgtcgcggcatgctcgcgtgcttcttcggcggcgtcgacgccgcg
acgcgcgacgcgctgcacgtgcacggcatccccgtgcacacgacgccgcagcgtctcgcg
cgcgcgcatgcgcgccttgtcgattatcaattgggccgggagctgttgatgcagacgccg
gagggcacgccgccgcaaccggcggcgtcgatctcggccgcgcggcacacggcgcgcgcg
gcgctcgcgcaggggcgcgacgggttcgaaggcgacgcggcgctcgaatggctggcgggt
ttcggcatcgagcgcgcgaccgacgcggacgtcgacatgggcgatacgatcgtcgacatc
acggtcgggatgtacgacgacccgaacttcgggccggtattccgctattcggtgccgccg
gcggatggcgtgtccgcgccgttcgtcgtctacgggctgccgcctttcaataccgtgctc
gcgcgcgcggtcgtcgcgcgatcgccgtatgcgcatcgcgcgccgcccgagccgcttctg
caggcactgaccgcgctttcgcaggcggtgtgcgatgtgcgcgaaatcgtcgagatgtcg
ctcgtgctgcgcgtgcggcccacacgcgtggtcgcgttggggccgcacatcaggctcgcg
acggggcgcagccggctcgcgatcgtgccatatccgcgctatctcgagcagcagctcgac
tggcgcggagaacgcatcacggtgcgtccgattcgccccgaggacgaggccgcgcatcgc
gagctgctgagcgcgatgacgccggacgatctgcgaatgcgcttcttcggtgcgatacgc
aacttcgaccattcgcagatcgcgcggatgacgcagatcgattacgaccgcgagatggcg
ctgatcgcgacgctcgacgatgccgacggccgcgcgcatacgctcggcgcggtgcgcgcg
gtgaccgatccggacaacgaagcgacggagttcgcgatcgcggtgcggcctgaccaaaag
ggcaaggggctcggacggatgttgatgacgcgcatcatcgactacgcgcgctcgcgcgga
acggcgtggatgatcggcgaggcactgcgcgagaacacggcgatgatctcgctcgcgaag
gacagcggttttgcggtgtcgtcgaccgaggagcctggggtggtggcgttccggctgaag
ctgcagccgtga

DBGET integrated database retrieval system