KEGG   Burkholderia pseudomallei 668: BURPS668_A3049Help
Entry
BURPS668_A3049    CDS       T00481                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase family protein
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bpd  Burkholderia pseudomallei 668
Brite
Enzymes [BR:bpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     BURPS668_A3049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase NAD_binding_10 3Beta_HSD NmrA GDP_Man_Dehyd NAD_binding_4 adh_short Polysacc_synt_2 RmlD_sub_bind PALP DFP adh_short_C2 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ABN88577
UniProt: A3NNW8
Position
II:2895826..2896833
Genome map
AA seq 335 aa AA seqDB search
MTDTQRDLVLVTGASGFVGSAVARAARRQGYRVRVLVRPTSPRTNVADLDAEIATGDMRD
EASMRAALRGVRHLLHVAADYRLWAPDPLEIERANLEGAVATMRAALAEGVERIVYTSSV
ATLKVTPSGASADESSPLAAGQAIGVYKRSKVLAERAVERMIAEDGLPAVIVNPSTPIGP
RDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVAQGHLLALERGRIGERYILGGENL
PLQAMLADIAQSMGRKPPTIALPRWPLYPIALGAEAVAKLTKREPFVTVDGLRMSKNKMY
FTSAKAERELGYRARPYREGIRDALDWFRQAGYLR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgactgacacacaacgcgatctcgttctggtgaccggcgcatccggttttgtcggctcc
gccgtcgcgcgcgccgcgcggcggcagggctatcgggtgcgcgtgctcgtgcggccgacg
agcccgcgcacgaacgtcgcggatctcgacgccgagatcgccaccggcgacatgcgcgac
gaggcatcgatgcgcgccgcgctgcgcggcgtgcgccatctgctgcacgtcgccgccgac
taccggctgtgggcgcccgatccgctcgagatcgagcgcgcgaatctcgaaggcgcggtc
gcgacgatgcgcgcggcgctcgccgagggcgtcgagcggatcgtctacacgagcagcgtc
gccacgctgaaggtgacgccgtcgggcgcctcggccgacgaatcgtcgccgctcgccgcc
gggcaggcgatcggcgtatacaagcgcagcaaggtgctcgccgagcgcgcggtcgagcgg
atgatcgccgaggacgggctgcccgcggtgatcgtcaatccgtcgacgccgatcggcccg
cgcgacgtgaagccgacgccgaccggccggatcatcgtcgaggcggcgctcggcaagatc
ccggcgttcgtcgacacggggctgaacctcgtgcacgtcgacgacgtcgcgcagggccac
ctgctcgcgctcgagcgcgggcgcatcggcgagcgctacatcctcggcggcgagaacctg
ccgctgcaggcgatgctcgccgacatcgcgcaatcgatgggacgcaagccgccgacgatc
gcgctgccgcgctggccgctgtatccgatcgcgctcggcgcggaggcggtggcgaagctg
acgaagcgcgagccgttcgtgacggtcgacgggctcaggatgtcgaagaacaagatgtat
ttcacgtccgcgaaagccgagcgcgagctcggctaccgcgcgcggccgtaccgcgaaggc
attcgcgacgcgctcgactggttcaggcaggcgggctatctgcgctga

DBGET integrated database retrieval system