KEGG   Burkholderia pseudomallei 668: BURPS668_A3049Help
Entry
BURPS668_A3049    CDS       T00481                                 

Definition
NAD-dependent epimerase/dehydratase family protein
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bpd  Burkholderia pseudomallei 668
Brite
Enzymes [BR:bpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     BURPS668_A3049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:2895826..2896833
Genome map
AA seq 335 aa AA seqDB search
MTDTQRDLVLVTGASGFVGSAVARAARRQGYRVRVLVRPTSPRTNVADLDAEIATGDMRD
EASMRAALRGVRHLLHVAADYRLWAPDPLEIERANLEGAVATMRAALAEGVERIVYTSSV
ATLKVTPSGASADESSPLAAGQAIGVYKRSKVLAERAVERMIAEDGLPAVIVNPSTPIGP
RDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVAQGHLLALERGRIGERYILGGENL
PLQAMLADIAQSMGRKPPTIALPRWPLYPIALGAEAVAKLTKREPFVTVDGLRMSKNKMY
FTSAKAERELGYRARPYREGIRDALDWFRQAGYLR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgactgacacacaacgcgatctcgttctggtgaccggcgcatccggttttgtcggctcc
gccgtcgcgcgcgccgcgcggcggcagggctatcgggtgcgcgtgctcgtgcggccgacg
agcccgcgcacgaacgtcgcggatctcgacgccgagatcgccaccggcgacatgcgcgac
gaggcatcgatgcgcgccgcgctgcgcggcgtgcgccatctgctgcacgtcgccgccgac
taccggctgtgggcgcccgatccgctcgagatcgagcgcgcgaatctcgaaggcgcggtc
gcgacgatgcgcgcggcgctcgccgagggcgtcgagcggatcgtctacacgagcagcgtc
gccacgctgaaggtgacgccgtcgggcgcctcggccgacgaatcgtcgccgctcgccgcc
gggcaggcgatcggcgtatacaagcgcagcaaggtgctcgccgagcgcgcggtcgagcgg
atgatcgccgaggacgggctgcccgcggtgatcgtcaatccgtcgacgccgatcggcccg
cgcgacgtgaagccgacgccgaccggccggatcatcgtcgaggcggcgctcggcaagatc
ccggcgttcgtcgacacggggctgaacctcgtgcacgtcgacgacgtcgcgcagggccac
ctgctcgcgctcgagcgcgggcgcatcggcgagcgctacatcctcggcggcgagaacctg
ccgctgcaggcgatgctcgccgacatcgcgcaatcgatgggacgcaagccgccgacgatc
gcgctgccgcgctggccgctgtatccgatcgcgctcggcgcggaggcggtggcgaagctg
acgaagcgcgagccgttcgtgacggtcgacgggctcaggatgtcgaagaacaagatgtat
ttcacgtccgcgaaagccgagcgcgagctcggctaccgcgcgcggccgtaccgcgaaggc
attcgcgacgcgctcgactggttcaggcaggcgggctatctgcgctga

DBGET integrated database retrieval system