KEGG   Bordetella pertussis Tohama I: BP0107Help
Entry
BP0107            CDS       T00139                                 

Gene name
rfbC
Definition
(RefSeq) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00521  Streptomycin biosynthesis
bpe00523  Polyketide sugar unit biosynthesis
bpe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BP0107 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BP0107 (rfbC)
Enzymes [BR:bpe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BP0107 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-GeneID: 2665304
NCBI-ProteinID: NP_879010
UniProt: Q7W0K7
Position
complement(104832..105380)
Genome map
AA seq 182 aa AA seqDB search
MKLTPLAIADVVLIEPQVFGDERGCFFESFNQDRLDAQLGRRIRFVQDNHSCSRAGVLRG
LHYQILHPQAKLVRVVAGEAYDVAVDLRRGSPTFGRWTGAYLSARNRHQLWIPEGFAHGF
LALSDDTECLYKATDYYAPEHERCVRWDDPQLKVDWPLQGQAPILSVKDRQGVALARADT
YA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcacccccttggccatcgcggacgtcgtgctgatcgaaccccaggtgttcggc
gacgagcgcggctgcttcttcgagagcttcaaccaggaccgcctggacgcgcaactgggg
cggcgcatccgcttcgtgcaggacaatcactcatgctcgcgcgcgggcgtgctgcgcggc
ctgcactaccagatcctgcatccgcaggccaagctggtgcgcgtggtggcgggcgaagcc
tatgacgtggcggtggacctgcgccgcggttcgcccaccttcgggcgctggaccggcgcc
tacctgtcggcgcgcaaccggcaccagctgtggattccggaaggatttgcgcacggcttc
ctggcgttgtccgacgataccgagtgcctgtacaaggccaccgactactacgcgcccgaa
catgagcgctgcgtgcgctgggacgacccgcaactcaaggtggactggccgctgcagggc
caagcgcccatcctgtcggtgaaagaccgccagggcgtggcgctggcgcgggccgatacc
tatgcgtag

DBGET integrated database retrieval system