KEGG   Bordetella pertussis Tohama I: BP0238Help
Entry
BP0238            CDS       T00139                                 

Gene name
folK
Definition
(RefSeq) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00790  Folate biosynthesis
bpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BP0238 (folK)
Enzymes [BR:bpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BP0238 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-GeneID: 2664242
NCBI-ProteinID: NP_879123
UniProt: Q7W0B1
Position
complement(246196..246687)
Genome map
AA seq 163 aa AA seqDB search
MNGSPASTLAYVGLGASLGDAAATLRSVLAELAAAPGILACKASRLYRTAPVEAQGPDFV
NAVAALDTTLAPLDLLDLLQALEQRHGRERPYRNAPRTLDLDLLLYGEQAIDHPRLSVPH
PRMHERAFVLAPLCELVPALRLAQGDCAALLAALEDQAIEPLR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcagcccggcttccaccctggcatacgtcggcctgggagccagcctgggcgac
gcggccgccacgctgcgcagcgtgcttgccgaactggccgccgcgccaggcatcctcgcc
tgcaaggcttcgcgcctgtaccggacggcgcccgtcgaggcccagggccccgacttcgtc
aacgcggtcgccgcgctcgacaccacgctggcgccgctggacctgctggacctgttgcag
gcgctggaacagcgccatggccgcgagcggccctaccgcaatgcgccgcgcaccctggac
ctggacctgctgctgtatggcgaacaggccatcgaccatccccgcctgagcgtgccgcat
ccgcgcatgcatgaacgcgccttcgtgctggcgccgctgtgcgaactggtccccgccctg
cgcctggcgcaaggcgactgcgcggcgctgctggccgcgctggaagaccaggccatcgag
ccgctgcgctga

DBGET integrated database retrieval system