KEGG   Bordetella pertussis Tohama I: BP0238Help
Entry
BP0238            CDS       T00139                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bpe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(246196..246687)
Genome map
AA seq 163 aa AA seqDB search
MNGSPASTLAYVGLGASLGDAAATLRSVLAELAAAPGILACKASRLYRTAPVEAQGPDFV
NAVAALDTTLAPLDLLDLLQALEQRHGRERPYRNAPRTLDLDLLLYGEQAIDHPRLSVPH
PRMHERAFVLAPLCELVPALRLAQGDCAALLAALEDQAIEPLR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcagcccggcttccaccctggcatacgtcggcctgggagccagcctgggcgac
gcggccgccacgctgcgcagcgtgcttgccgaactggccgccgcgccaggcatcctcgcc
tgcaaggcttcgcgcctgtaccggacggcgcccgtcgaggcccagggccccgacttcgtc
aacgcggtcgccgcgctcgacaccacgctggcgccgctggacctgctggacctgttgcag
gcgctggaacagcgccatggccgcgagcggccctaccgcaatgcgccgcgcaccctggac
ctggacctgctgctgtatggcgaacaggccatcgaccatccccgcctgagcgtgccgcat
ccgcgcatgcatgaacgcgccttcgtgctggcgccgctgtgcgaactggtccccgccctg
cgcctggcgcaaggcgactgcgcggcgctgctggccgcgctggaagaccaggccatcgag
ccgctgcgctga

DBGET integrated database retrieval system