KEGG   Bordetella pertussis Tohama I: BP0538Help
Entry
BP0538            CDS       T00139                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bpe01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bpe00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(546339..547283)
Genome map
AA seq 314 aa AA seqDB search
MIAASFPHGVSLIGAPTDIGAGQRGASMGPEALRVAGLVRLLERRGLQVTDRGNLQGAPN
PWRPPANGYRHLNEVIGWNQLVHDAVSAELRQERLPILLGGDHSLAIGSISAVARYCRAS
GRKLRVLWLDAHADFNTNRLTPTGNVHGMPVACLCGNGPAALTSMAGRTPAIEPGWVRQI
GIRSVDEGERNLVYDAGLEVYDMRYLDEVGMRAVMEAALAGLDPQTHLHVSFDVDFLDPE
LAPGVGTTVPGGPTYREAQLCMEMIADTGLMRSRDIVELNPALDVRNKTAQVAVDLVESL
FGKSTLMRRRPGSA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgctgcatcgttcccccacggggtcagcctgatcggcgcgcccaccgacatcggc
gcgggccagcgcggcgcttccatggggcccgaggccctgcgcgtggcgggcctggtgcgc
ctgctcgagcggcgcggcctgcaagtgaccgatcgcggcaacctgcagggcgcgcccaac
ccgtggcgcccgccggccaacggctaccggcacctcaacgaagtcatcggctggaaccag
ctcgtgcacgacgccgtcagcgccgagttgcgccaggagcgcctgcccatcctgctgggc
ggcgaccacagcctggccatcggctcgatcagcgcggtggcgcgctattgccgcgcgagt
ggccgcaagctgcgcgtgctgtggctggacgcgcacgccgacttcaataccaaccggctc
acgcccaccggcaacgtgcacggcatgccggtcgcctgcctgtgcggcaacggccccgcg
gcactgaccagcatggccggccgcacgccggccatcgaaccgggctgggtgcgccagatc
ggcatccgcagcgtggacgaaggcgaacgcaacctggtctacgacgccgggctggaggtc
tacgacatgcgctatctcgacgaggtcggcatgcgcgcggtgatggaggccgccctggcc
gggctggacccgcagacgcatttgcacgtcagcttcgacgtcgacttcctcgaccccgag
ctggcgccgggcgtgggcacgaccgtgcccggcggtcccacctatcgcgaagcccagctg
tgcatggaaatgatcgccgacaccggcctgatgcgctcgcgggacatcgtcgaactcaat
cccgcgctggacgtgcgcaacaagaccgcccaggtcgcggtggacctggtcgaaagcctg
ttcggcaaatccaccctgatgcgccggcgccccggcagcgcctga

DBGET integrated database retrieval system