KEGG   Bordetella pertussis Tohama I: BP0607Help
Entry
BP0607            CDS       T00139                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BP0607 (gpmA)
   01230 Biosynthesis of amino acids
    BP0607 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP0607 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BP0607 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BP0607 (gpmA)
Enzymes [BR:bpe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BP0607 (gpmA)
Exosome [BR:bpe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BP0607 (gpmA)
  Exosomal proteins of melanoma cells
   BP0607 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
611521..612273
Genome map
AA seq 250 aa AA seqDB search
MYKLVLMRHGESQWNLENRFTGWTDVDLTETGREQARKAGELLKREGYAFDLAYTSVLKR
AIRTLWIALDAMDAMYTPVGINWRLNERHYGQLQGLNKAETAAKYGDEQVLIWRRAYAIA
PEPLDLEDPRHPRFDGRYAKIPADQLPATECLKDTVARVLPFWNESIAPAIRAGRRVLVA
AHGNSLRALIKHLDNVSDDDIVGVNIPTGQPLVYELDEDLKPIRHYYLGDAAEIEAAMAA
VAAQGKAKKD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaacttgttctgatgcgccacggcgaaagccagtggaacctggaaaaccgtttc
acgggctggaccgatgtggacctgaccgaaaccggccgcgagcaggcccgcaaggcgggc
gaattgctcaagcgcgagggttacgccttcgacctggcctatacctcggtgctcaagcgc
gccatccgcacgctctggatcgccctggacgccatggacgccatgtataccccggtgggc
atcaactggcgcctgaacgagcgccactacggccagctgcaaggcctgaacaaggccgag
accgccgccaagtacggcgacgagcaggtgctgatctggcgccgcgcctacgcgatcgcc
ccggagccgctggacctggaagatccgcgccacccgcgtttcgacggccgctacgccaag
atcccggccgaccagctgccggccaccgaatgcctgaaggatacggtggcgcgcgtgctg
ccgttctggaacgaatcgatcgccccggccatccgcgccggccgccgcgtcctggtggcc
gcgcatggcaacagcctgcgcgcgctgatcaagcacctcgacaatgtttccgatgatgac
atcgtgggcgtgaatattccgaccggccagcctctggtgtatgaattggatgaggacctg
aagccgattcgccactattatctgggcgatgccgccgagatcgaggcggcgatggctgcc
gtggcggcgcagggcaaggcgaaaaaggactga

DBGET integrated database retrieval system