KEGG   Bordetella pertussis Tohama I: BP0640Help
Entry
BP0640            CDS       T00139                                 

Definition
acyl-CoA dehydrogenase
Orthology
K11731  
citronellyl-CoA dehydrogenase [EC:1.3.99.-]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Geraniol degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    BP0640
Enzymes [BR:bpe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other acceptors
    1.3.99.-  
     BP0640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
646789..647949
Genome map
AA seq 386 aa AA seqDB search
MQFTHEHRELARTTRRIIAEHLDPYLDEWEAAQMFPAHQVMKALGSAGLLGIGKPAEYGG
MALDFSYEMVFAETLGEVRSSGLSSAIGVQSTMCTPALARHGSDALKRAYLAPTIAGDLV
GCIGASEASAGSDVSQIKTWARRDGDDYVINGSKMWITNGVQGDWICLLCNTSQEGGPHK
NKSLIIVPLDTPGVSVSRKLDKLVLRASDTAELFFDDVRVPVSNRIGAENMGFIYQMEQF
QEERMFVAARGMRSMERVIEETIAYAGQRQVFGGTVLSNQVVYHKLAQMQTEIEALRSLL
YRAIGQYLDGQDITQLASMAKYCAGRLSMRIPNECLQFWGGQGVMNENWISRAYRDLRQT
AIGGGANEIMLEVIAKTMGIHPGKRA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcacccacgagcaccgcgagctggcgcggaccacgcggcgcatcatcgccgaa
cacctcgacccctatctcgacgaatgggaagcggcgcagatgtttcccgcccaccaggtc
atgaaggcgctgggctcggccggcctgctgggcatcggcaagcccgccgaatacggcggc
atggcactggatttcagctacgagatggtgtttgccgagacgctgggcgaagtccgctcc
agcggcctgagctcggcgatcggcgtgcaaagcaccatgtgcacgccggcgctcgcgcgc
cacggcagcgacgcgctcaagcgcgcgtacctggcgcccaccatcgccggcgacctggtg
ggctgcatcggcgccagcgaagcctcggccggctcggacgtgtcgcagatcaagacctgg
gcgcgccgcgacggcgacgactacgtgatcaacggctcgaagatgtggatcaccaacggc
gtacagggcgactggatctgcctgctgtgcaacacctcgcaggaaggcggcccgcacaag
aacaagtcgctcatcatcgtgccgctggatacgcccggcgtcagcgtctcgcgcaagctg
gacaagctggtgctgcgcgcttccgacacggccgagctgttcttcgacgacgtgcgcgtg
cccgtctccaaccgcatcggcgcggagaacatgggcttcatctaccagatggagcagttc
caggaagaacgcatgttcgtcgccgcgcgcggcatgcgctcgatggagcgcgtcatcgag
gagaccatcgcctacgccggccagcggcaggtgttcggcggcaccgtgctgtcgaaccag
gtcgtctatcacaagctggcgcagatgcagaccgagatcgaggcgctgcgctcgctgctg
taccgcgccatcggccagtacctggacgggcaggacatcacgcaactggcgtccatggcc
aagtattgcgcgggcaggctgtcgatgcggattcccaacgagtgcctgcagttctggggc
ggacaaggcgtgatgaacgagaactggatctcgcgcgcctatcgcgacctgcggcagacc
gccatcggcggcggcgccaacgaaatcatgctggaagtcattgccaagaccatgggcatc
cacccgggcaagcgcgcctga

DBGET integrated database retrieval system