KEGG   Bordetella pertussis Tohama I: BP0661Help
Entry
BP0661            CDS       T00139                                 

Definition
(RefSeq) acetyl-CoA synthetase
Organism
bpe  Bordetella pertussis Tohama I
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 Succ_CoA_lig CoA_binding_2 ATP-grasp_2 CoA_binding CPSase_L_D2
Motif
Other DBs
NCBI-GeneID: 2667729
NCBI-ProteinID: NP_879498
UniProt: Q7VRZ8
Position
complement(669639..671780)
Genome map
AA seq 713 aa AA seqDB search
MDNASVSPGFTRPPRLSVARIVAPGSIAVVGASDDLKKFGGRIIHYVTRNGYRGTVIPVN
PRRAEVAGLLAVPSIAHLGPVDVAILALPVDMIEQAIGECAAAGVGACVIVSAGFAELGD
EGVARQDRIVRIAREAGMRLVGPNCMGIINPHHRMALTSSLVVEQGELLPGNIGLISQSG
ALMVSMYDRACREQIRFSACVSLGNQCDLEICDFFEYMIDDPLTRVITMYVEGFVDTGRF
AKLARRAQRAGKPVLLTKTGRTAAGAEAARSHTASLAGNYRALEALCEATGVTIVDDPDG
MLQLAAILARFGRCAAEGVGIVSPSGGAIGIGVDRLSDVGIRLGRLDAASQQLLGTVMNP
SHAFNPVDLGNRTTEEMSQLRTIVQAYNQAPDIGVIFVILTTSPHFEQVTLALGQAMAQA
GGKPVLFLVTPGGVADNCRTLLQDLGLPYVDRMDDATRILRHYVPKADALPARDAPRPAS
WPMPEGAGRMLGARPGESEVKALLRAYGIPLAQERFCRTAEQAVEAARAIGFPVVLKAVS
AQLVHKSDIGAVKLRLADDAAVRRAWAEIEQALSSQVDGAVLDGCLVAEMVTAQSELLVG
AINDAQFGPMIMVGFGGVTVELVPDTQLAVAPVDTEQAMALLRRLKQWPLLDGYRGMPKA
DVAAVAEVVSRVSWLIADLRDQVAELDINPLLIRAGDGKPIGVDARAAMLGPG
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgcttccgtatcgcccggttttaccaggccgccccggttgagcgtggcgcgc
atcgtcgcgccgggttcgatcgccgtcgtgggggcctccgacgacctgaagaagttcggc
ggccgcatcatccactacgtcacgcgcaacggctaccgcggcaccgtgatacccgtcaac
ccgcgcagggccgaagtggcggggctgctggcggtgccgagcatcgcccacctgggtccg
gtggatgtcgccatcctcgcgctgccggtggacatgatcgagcaggccatcggcgaatgc
gccgcggcgggcgtgggcgcctgcgtgatcgtgtcggcggggttcgccgagctgggcgac
gaaggcgtcgcgcggcaggaccggatcgtgcgcattgcgcgcgaggcgggcatgcggctg
gtgggtccgaactgcatgggcatcatcaatccccaccatcgcatggcgttgacgtcctcg
ctggtggtggaacagggcgagctgctgccgggcaacatcggcctgatcagccagagcggc
gcgctcatggtgtcgatgtacgaccgggcatgccgcgagcagatccgcttcagcgcctgc
gtgtcgctgggcaaccagtgcgacctggagatctgcgacttcttcgagtacatgatcgac
gatccgctgacgcgcgtcatcacgatgtatgtcgaaggtttcgtcgataccggccggttc
gccaagctggcgcgccgcgcgcagcgcgcgggcaagcccgtgctcctgaccaagaccggc
cgcaccgccgccggcgccgaggccgcgcgctcgcataccgccagcctggcgggcaactac
cgggcgctcgaagcgctgtgcgaagccacgggcgtgacgatcgtcgacgaccccgacggg
atgctgcagctggccgcgatcctggcgcgattcgggcgatgcgccgccgaaggcgtgggc
attgtttccccgtcgggcggcgccatcgggatcggggtcgaccgcctgtccgacgtgggc
atccggctgggcaggctggacgccgcgtcccagcagttgctgggcacggtgatgaacccc
agccatgccttcaatccggtggacctgggcaatcggaccacggaagagatgagccagctg
cgcaccatcgtgcaggcatacaaccaggcgcccgatatcggcgtcattttcgtcattctc
acgacttcgccgcacttcgagcaggtgacgctggcgctgggccaggccatggcgcaggcg
ggcggcaagccggtgctgttcctggtgacgcccgggggcgtggccgacaactgccggacc
ttgctgcaggatctgggcctgccttatgtcgatcgcatggatgatgcgacccgcatcctg
cggcactacgtgccgaaggccgacgccctgcccgcccgggacgcgccgcggcccgcgtcg
tggccgatgcccgagggcgccggccgcatgctgggcgcgcgtcccggcgaatccgaggtc
aaggcgctgctgcgcgcgtacgggatcccgctggcgcaagagcgtttctgccgcacggcc
gaacaagccgtcgaggccgcgcgggccatcggctttcccgtggtactcaaggctgtcagc
gcgcaactcgtgcacaagagcgatatcggggcggtcaagctgaggctggcggacgacgcg
gccgtgcggcgcgcctgggcggagatcgaacaggccctgtccagccaggtcgacggcgcc
gtgctcgatggctgcctggtggccgagatggtgaccgcgcaaagcgagctgctggttggc
gcgatcaacgacgcccagttcggcccgatgatcatggtcgggttcggcggggtcaccgtg
gagctggtgccggatacccagttggcggtggcgcccgtggacacggaacaggccatggcg
ctattgcggcggctcaagcaatggccgctgctcgatggctaccgaggcatgcccaaggcg
gatgtggcggccgtggccgaggtcgtcagccgggtcagctggctgatcgcggacttgcgc
gaccaggtggccgagctcgacatcaatccgttgctgatccgggccggggacggcaagccg
atcggcgtggatgcgcgggccgccatgctcggcccgggctga

DBGET integrated database retrieval system