KEGG   Bordetella pertussis Tohama I: BP0661Help
Entry
BP0661            CDS       T00139                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.13)
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP0661
   00620 Pyruvate metabolism
    BP0661
   00640 Propanoate metabolism
    BP0661
Enzymes [BR:bpe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     BP0661
Lipid biosynthesis proteins [BR:bpe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BP0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(669639..671780)
Genome map
AA seq 713 aa AA seqDB search
MDNASVSPGFTRPPRLSVARIVAPGSIAVVGASDDLKKFGGRIIHYVTRNGYRGTVIPVN
PRRAEVAGLLAVPSIAHLGPVDVAILALPVDMIEQAIGECAAAGVGACVIVSAGFAELGD
EGVARQDRIVRIAREAGMRLVGPNCMGIINPHHRMALTSSLVVEQGELLPGNIGLISQSG
ALMVSMYDRACREQIRFSACVSLGNQCDLEICDFFEYMIDDPLTRVITMYVEGFVDTGRF
AKLARRAQRAGKPVLLTKTGRTAAGAEAARSHTASLAGNYRALEALCEATGVTIVDDPDG
MLQLAAILARFGRCAAEGVGIVSPSGGAIGIGVDRLSDVGIRLGRLDAASQQLLGTVMNP
SHAFNPVDLGNRTTEEMSQLRTIVQAYNQAPDIGVIFVILTTSPHFEQVTLALGQAMAQA
GGKPVLFLVTPGGVADNCRTLLQDLGLPYVDRMDDATRILRHYVPKADALPARDAPRPAS
WPMPEGAGRMLGARPGESEVKALLRAYGIPLAQERFCRTAEQAVEAARAIGFPVVLKAVS
AQLVHKSDIGAVKLRLADDAAVRRAWAEIEQALSSQVDGAVLDGCLVAEMVTAQSELLVG
AINDAQFGPMIMVGFGGVTVELVPDTQLAVAPVDTEQAMALLRRLKQWPLLDGYRGMPKA
DVAAVAEVVSRVSWLIADLRDQVAELDINPLLIRAGDGKPIGVDARAAMLGPG
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgcttccgtatcgcccggttttaccaggccgccccggttgagcgtggcgcgc
atcgtcgcgccgggttcgatcgccgtcgtgggggcctccgacgacctgaagaagttcggc
ggccgcatcatccactacgtcacgcgcaacggctaccgcggcaccgtgatacccgtcaac
ccgcgcagggccgaagtggcggggctgctggcggtgccgagcatcgcccacctgggtccg
gtggatgtcgccatcctcgcgctgccggtggacatgatcgagcaggccatcggcgaatgc
gccgcggcgggcgtgggcgcctgcgtgatcgtgtcggcggggttcgccgagctgggcgac
gaaggcgtcgcgcggcaggaccggatcgtgcgcattgcgcgcgaggcgggcatgcggctg
gtgggtccgaactgcatgggcatcatcaatccccaccatcgcatggcgttgacgtcctcg
ctggtggtggaacagggcgagctgctgccgggcaacatcggcctgatcagccagagcggc
gcgctcatggtgtcgatgtacgaccgggcatgccgcgagcagatccgcttcagcgcctgc
gtgtcgctgggcaaccagtgcgacctggagatctgcgacttcttcgagtacatgatcgac
gatccgctgacgcgcgtcatcacgatgtatgtcgaaggtttcgtcgataccggccggttc
gccaagctggcgcgccgcgcgcagcgcgcgggcaagcccgtgctcctgaccaagaccggc
cgcaccgccgccggcgccgaggccgcgcgctcgcataccgccagcctggcgggcaactac
cgggcgctcgaagcgctgtgcgaagccacgggcgtgacgatcgtcgacgaccccgacggg
atgctgcagctggccgcgatcctggcgcgattcgggcgatgcgccgccgaaggcgtgggc
attgtttccccgtcgggcggcgccatcgggatcggggtcgaccgcctgtccgacgtgggc
atccggctgggcaggctggacgccgcgtcccagcagttgctgggcacggtgatgaacccc
agccatgccttcaatccggtggacctgggcaatcggaccacggaagagatgagccagctg
cgcaccatcgtgcaggcatacaaccaggcgcccgatatcggcgtcattttcgtcattctc
acgacttcgccgcacttcgagcaggtgacgctggcgctgggccaggccatggcgcaggcg
ggcggcaagccggtgctgttcctggtgacgcccgggggcgtggccgacaactgccggacc
ttgctgcaggatctgggcctgccttatgtcgatcgcatggatgatgcgacccgcatcctg
cggcactacgtgccgaaggccgacgccctgcccgcccgggacgcgccgcggcccgcgtcg
tggccgatgcccgagggcgccggccgcatgctgggcgcgcgtcccggcgaatccgaggtc
aaggcgctgctgcgcgcgtacgggatcccgctggcgcaagagcgtttctgccgcacggcc
gaacaagccgtcgaggccgcgcgggccatcggctttcccgtggtactcaaggctgtcagc
gcgcaactcgtgcacaagagcgatatcggggcggtcaagctgaggctggcggacgacgcg
gccgtgcggcgcgcctgggcggagatcgaacaggccctgtccagccaggtcgacggcgcc
gtgctcgatggctgcctggtggccgagatggtgaccgcgcaaagcgagctgctggttggc
gcgatcaacgacgcccagttcggcccgatgatcatggtcgggttcggcggggtcaccgtg
gagctggtgccggatacccagttggcggtggcgcccgtggacacggaacaggccatggcg
ctattgcggcggctcaagcaatggccgctgctcgatggctaccgaggcatgcccaaggcg
gatgtggcggccgtggccgaggtcgtcagccgggtcagctggctgatcgcggacttgcgc
gaccaggtggccgagctcgacatcaatccgttgctgatccgggccggggacggcaagccg
atcggcgtggatgcgcgggccgccatgctcggcccgggctga

DBGET integrated database retrieval system