KEGG   Bordetella pertussis Tohama I: BP0801Help
Entry
BP0801            CDS       T00139                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BP0801 (tpiA)
   01230 Biosynthesis of amino acids
    BP0801 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP0801 (tpiA)
   00051 Fructose and mannose metabolism
    BP0801 (tpiA)
   00562 Inositol phosphate metabolism
    BP0801 (tpiA)
Enzymes [BR:bpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BP0801 (tpiA)
Exosome [BR:bpe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BP0801 (tpiA)
  Exosomal proteins of bladder cancer cells
   BP0801 (tpiA)
  Exosomal proteins of melanoma cells
   BP0801 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
824318..825064
Genome map
AA seq 248 aa AA seqDB search
MTTAENRARLVLGNWKMHGNLAENAALLAELRAADAAAHCEMGVCVPFPYLAQTAAALQG
SAIGWGAQDVSAHAKGAYTGEVAAPMLAEFGCRWVLVGHSERRTLHAESDQLVADKARAA
LEAGLTPVVCVGESLQEREGGNTLGVIERQLEPVLALGRDALVRMVLAYEPVWAIGTGRT
ASPEQAQEVHSAIRVALDGLQASQVRVLYGGSVKGANAASLFAMPDIDGGLVGGASLVAE
EFLRIAAA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagctgagaatcgcgcccgcctggtgctgggcaactggaagatgcacggcaac
ctggccgagaacgccgccttgctggccgagttgcgcgccgccgatgccgccgcccattgc
gaaatgggggtgtgcgtgccgtttccgtacctggcccagaccgctgccgccttgcagggc
agcgccatcggctggggcgcgcaggatgtcagcgcgcacgccaagggcgcctacaccggc
gaagtcgccgcccccatgctggccgaattcggctgccgctgggtgctggtgggccactcc
gagcggcgcacgctgcatgccgagagcgaccagctggtggccgacaaggcccgcgccgcg
ctcgaggcaggcctgaccccggtggtttgcgtcggcgaatcgctgcaagagcgcgaaggc
ggcaacaccctgggcgtgatcgagcgccagctcgaacccgtcctggccctgggccgcgat
gccctggtccgcatggtcctcgcctacgaacccgtctgggccatcggcaccggccgtact
gccagccccgagcaggcgcaggaagtgcacagcgccatccgcgtggcgctcgacggcctg
caagccagccaggtgcgcgtgctgtacggcggcagcgtcaagggggccaacgccgccagc
ctgttcgccatgcccgacatcgacggcggcctggtgggcggggcctcgctcgtcgctgaa
gaattcctgcgcatcgccgcagcttaa

DBGET integrated database retrieval system