KEGG   Bordetella pertussis Tohama I: BP0994Help
Entry
BP0994            CDS       T00139                                 

Gene name
aceF
Definition
(RefSeq) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00010  Glycolysis / Gluconeogenesis
bpe00020  Citrate cycle (TCA cycle)
bpe00620  Pyruvate metabolism
bpe01100  Metabolic pathways
bpe01110  Biosynthesis of secondary metabolites
bpe01120  Microbial metabolism in diverse environments
bpe01130  Biosynthesis of antibiotics
bpe01200  Carbon metabolism
Module
bpe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP0994 (aceF)
   00020 Citrate cycle (TCA cycle)
    BP0994 (aceF)
   00620 Pyruvate metabolism
    BP0994 (aceF)
Enzymes [BR:bpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BP0994 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 RnfC_N Peptidase_M23 HlyD_3
Motif
Other DBs
NCBI-GeneID: 2664546
NCBI-ProteinID: NP_879788
UniProt: Q7VZC4
Position
1036714..1038375
Genome map
AA seq 553 aa AA seqDB search
MSNIVEIKVPDIGDFKEVEVIEVLVSAGDTIKAEQSLITVESDKASMEIPASAAGVVKSV
KVKVGDKIAEGTVILEVEAAGEAAAAPKAEAPKAEAPKAEQAAETPKADAAKAEAPQAQA
AQAEAPAAAGPIEVKVPDIGDFKEVEVIEVLVAEGDTIKAEQSLITVESDKASMEIPASA
GGVVQSLKVKVGDKVAMGTVIAVVQGQGAAAAPAAAEPAAPASPVAPASAPAQRPAPAAA
LQDEDLKPGQLPHASPSVRKFARELGVNLSRVTGSAAKGRITADDVRAYVKQALSAGAPA
GASGGGDGAALGLLPWPKIDFTKFGPIEAKPLSRIKKISGANLHRNWVMIPHVTNNDEAD
ITDLEALRVALNKENEKSGVKVTMLAFLIKAVVAALKKFPEFNASLDGDNLVLKQYYHIG
FAADTPNGLVVPVVRDADKKGILELARETSELARKAREGKASPAEMQGGCFSISSLGGIG
GTHFTPIINAPEVAILGVSRSAHKPVWDGKQFVPRLTLPLSLSYDHRVIDGASAARFNAY
LGQLLVDFRRIAL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatatcgtggaaatcaaggtaccggacatcggtgacttcaaggaggtggaagtc
atcgaggtgctggtatcggcgggcgacacgatcaaggccgagcaaagcctgatcacggtg
gagtccgacaaggcatcgatggagattccggcctcggccgcgggcgtggtgaagtcggtc
aaggtgaaggtgggcgacaagatcgccgaaggcacggtcatcctggaagtggaggcggcc
ggcgaggccgccgccgcgcccaaggccgaggcccccaaggccgaggcccccaaggccgag
caggccgccgagacgcccaaggccgacgccgcgaaggccgaggcgccccaggcgcaggcg
gcccaggccgaggcgccggccgccgccggcccgatcgaagtcaaggtgcccgatatcggc
gacttcaaggaagtcgaggtcatcgaggtgctggtcgccgagggcgacaccatcaaggcc
gagcaaagcctgatcacggtcgagtccgacaaggcctcgatggaaatcccggcctcggcg
ggcggcgtggtgcagtcgctcaaggtcaaggtaggcgacaaggtcgcgatgggcacggtc
atcgccgtggtgcagggccagggcgccgccgcggcgccggccgcagccgagcccgccgcg
ccggcttcgcccgtggccccggcttcggctccggcgcagcggcccgccccggccgccgcg
ctgcaggacgaagacctcaagcccggccaattgccgcatgcctcgccgtcggtgcgcaag
ttcgcgcgcgagctgggcgtgaacctgagccgcgtcaccggctcggccgccaagggccgc
atcacggccgatgacgtgcgcgcctacgtgaagcaggcgctgtcggctggtgcgccggct
ggcgcctcgggcggcggcgatggcgccgcgctggggctgctgccgtggcccaagatcgat
ttcaccaagttcggccccatcgaagccaagccgctgtcgcgcatcaagaagatctcgggc
gccaacctgcaccgcaactgggtcatgatcccgcacgtcaccaacaacgacgaagcggac
atcaccgacctggaggcgctgcgcgtggcgctgaacaaggagaacgagaaatcgggcgtc
aaggtcaccatgctggccttcctgatcaaggcggtggtcgcggcgctgaagaagttcccc
gagttcaacgcctcgctggatggcgacaacctggtgctcaagcagtactaccacatcggc
ttcgccgccgacacgcccaacgggctggtggtgccggtggtgcgcgacgccgacaagaag
ggcatcctggagctggcccgcgaaacctccgagctggccaggaaggcccgcgaaggcaag
gcctcgcccgccgagatgcagggcggctgcttctcgatctcgtcgctgggcggcatcggc
ggcacgcatttcacgcccatcatcaacgcgcccgaagtggccatcctgggcgtgtcgcgc
tcggcccacaagccggtctgggacggcaagcagttcgtgccgcgcctgaccctgccgctg
tcgctgtcctatgaccaccgcgtcatcgacggcgcctcggcggcgcgcttcaacgcctat
ctcggccagctgctggtcgacttccgccgcatcgcgctgtaa

DBGET integrated database retrieval system