KEGG   Bordetella pertussis Tohama I: BP1578Help
Entry
BP1578            CDS       T00139                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bpe00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(1657141..1657773)
Genome map
AA seq 210 aa AA seqDB search
MSAPSGNVFMVVAPSGAGKSSLVRALLDRDPSLVLSISCTTRAPRPGEQDGREYRFVDQA
EFARLRDAQQLLEWAEVHGNFYGTPRDRIDEATRAGHDVLLEIDWQGARQVKQRYPEAIG
IFVLPPSIDELESRLKARGQDAPQVIARRLLAAGGEIAHAPECEYVIINQEFSVALTELV
QIISAARLRFSSQAVRNAQLFSQLGIPAAH
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaccctccggcaatgtattcatggtcgtcgctcccagcggcgccggcaagtcc
agcctggttcgcgccctgctcgaccgcgatccctctctcgtgctgtccatttcgtgcacc
acgcgcgcgccgcgccccggcgagcaagacggccgcgagtaccgcttcgtcgaccaggcc
gaattcgcccgcctgcgcgatgcgcaacagctgctcgaatgggccgaggtgcacgggaat
ttctatggcaccccgcgcgaccgcatcgacgaggccacccgcgccggccatgacgtcctg
ctggaaatcgactggcagggcgcgcggcaggtcaagcagcgctaccccgaggccatcggc
atattcgtcctgccgccttccatcgacgagctggaaagccgcctgaaggcccgcggccag
gatgcgccccaggtcatcgcgcgccgcctgctggctgccggcggcgagatcgcgcacgcg
cctgaatgcgaatatgttattattaatcaagaatttagcgtagccctgacggaactggtg
caaatcatcagtgccgcgcggctgcgtttttcgtcccaggccgtgcgcaatgcgcagttg
ttctcgcaactgggcatacccgccgcgcactga

DBGET integrated database retrieval system