KEGG   Bordetella pertussis Tohama I: BP1720Help
Entry
BP1720            CDS       T00139                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bpe  Bordetella pertussis Tohama I
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1804767..1805405
Genome map
AA seq 212 aa AA seqDB search
MNSDRLRQAMVQRLRAQGIADERVLNAMAAVPRHLFVDEALASRAYEDAALPIGHSQTIS
QPWVVARMIAAVCEDRAPARVLEVGAGCGYQAAVLAQIVREVHAIERIRGLYELARGHLR
ALRLATRVRLIHGDGMLGVPGVAPFDAIVVAAAGLAIPQALLDQLAPGGRLIAPEGSTHQ
RLVLIERTGATAWSRKELEAVRFVPLRAGIQS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
ttgaactccgaccggctgcgccaggcgatggtgcagcggttgcgcgcgcagggcatcgcc
gacgaacgggtgctcaacgccatggcggcggtgccgcgccatctgttcgtcgacgaagcg
ctggccagccgtgcctacgaagacgcggcgctgcccatcgggcactcgcagaccatttcg
cagccgtgggtggtggcccgcatgatcgccgctgtctgcgaggaccgtgctccggcgcgg
gtgctcgaggttggcgccggctgcggctaccaggcggcggtactggcccagatcgtgcgc
gaggtgcatgccatcgagcgtatccgcggcctgtacgagctggcgcgcggccatctgcgg
gcgctgcgcctggccacccgggtgcgcctgatccatggcgacggcatgctgggcgtgccc
ggcgtggcgccgttcgatgctattgttgtggctgcggcgggcctggccattccgcaggcc
ttgctggatcagcttgcgccgggcgggcggctgatcgcgcccgaagggtccacccaccag
cggctggtgctgatcgaacgcaccggggccaccgcgtggagccgaaaagaactcgaagct
gtacgttttgtgcccctcagggccggaatacaatcttga

DBGET integrated database retrieval system