KEGG   Bordetella pertussis Tohama I: BP1733Help
Entry
BP1733            CDS       T00139                                 

Gene name
tesA
Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bpe01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(1817370..1817978)
Genome map
AA seq 202 aa AA seqDB search
MPAQAQTASAPTGSAPHAVLVVGDSLSAEYGLRRGSGWVPMLAQRVSQQSPNYRVVNASI
SGDTTSGGLARLPALLRQHAPAVVVLELGSNDALRGLALDMTERNLRAMAQASRQAGASV
LVVGMQIPPNYGRDYTQRFAQVFPAVAEQEKARLVPFLMEGIATNRAMFQADGIHPNENA
QPALLDNVWPLLEPMLAQPAAD
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgccggcccaggctcagaccgcgtccgcgcccacaggttccgcaccgcacgccgtcctg
gtggtcggcgacagcctgtcggccgaatacggcctgcggcgcgggtccggctgggtgccg
atgctggcccagcgggtttcgcaacaatcccccaactaccgcgtcgtcaatgccagcatc
agcggcgatacgaccagcggcgggctggcgcgcctgccggcgctgctgcgccagcacgcg
ccggccgtcgtcgtgctggaactggggtccaacgatgccctgcgcggcctggcgctggac
atgaccgagcgcaatctgcgcgccatggcgcaggcgtcgcgccaggccggcgcatcggtg
ctggtggtcggcatgcagatcccgccgaactacggccgcgactacacccagcgcttcgcg
caggtctttccagccgtggccgaacaggaaaaagcccggctggtgccgttcctcatggaa
ggaatcgccaccaaccgggccatgttccaggccgacggcatccatcccaacgagaacgcc
cagccggcgctgcttgacaatgtctggcccttgctcgagccgatgctggctcagcctgcg
gccgactga

DBGET integrated database retrieval system