KEGG   Bordetella pertussis Tohama I: BP1758Help
Entry
BP1758            CDS       T00139                                 

Definition
(RefSeq) fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe01040  Biosynthesis of unsaturated fatty acids
bpe01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BP1758
Enzymes [BR:bpe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BP1758
Lipid biosynthesis proteins [BR:bpe01004]
 Desaturase
  First
   BP1758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3 ABATE
Motif
Other DBs
NCBI-GeneID: 2666504
NCBI-ProteinID: NP_880470
UniProt: Q7VXJ9
Position
1845161..1846369
Genome map
AA seq 402 aa AA seqDB search
MDSILSFISGGLTQATWWQIVLFTLVVTHITIVSVTVFLHRSQAHRGLDLHPAVMHFFRF
WLWMTTGMVTKEWVAIHRKHHAKCEKEGDPHSPMLFGIWKVLFRGAELYREESANKETMA
KFGHGTPDDWLERNIYSKHSLAGVLTMLAIDLALFGAVGLTVWAVQMAWIPFWAAGVVNG
IGHYWGYRNYNSPDTSTNVFPWGIIIGGEELHNNHHAHGTSAKFSAKWYELDIGWGYISI
LKFFGLAKVKKVAPKLKLESGSKGIDLSTLQGVITHRYEVMARYGDLVKRAAREELSKLK
SSRQQDAANCRWTTLRRVRRWLHRNEEVLQPEQRAEVDQAIAQNQSLSTLVQMRRELGRL
WESSSASSEQLLHDLQAWCQRAQQSGIAGLEQFALHLRRYAA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggattccatcctttctttcatttccggcggtctgacccaagccacttggtggcagatc
gtgctgttcaccctggtcgtgacgcacatcaccattgtgtcggtcacggtgttcctgcac
cgcagccaggcgcaccgcggcctggacctgcatccggcagtgatgcatttcttccgcttc
tggctctggatgaccaccggcatggtcaccaaggagtgggtcgccatccaccgcaagcac
catgccaagtgcgagaaggaaggcgatccccattcgccgatgctgttcggcatctggaag
gtgctgttccgcggcgccgagctgtatcgcgaggagtccgccaacaaggaaaccatggcc
aagttcggccacggcacgcccgatgactggctcgaacgcaacatctattccaagcacagc
ctggccggcgtgctcaccatgctggccatcgacctggccctgttcggggccgtcggcctg
acggtctgggcggtgcagatggcctggatcccgttctgggcggccggcgtggtcaatggc
atcggtcattactggggctaccgcaactacaacagcccggacaccagcaccaacgtgttc
ccgtggggcatcatcatcggcggcgaagagctgcacaacaaccaccacgcgcacggcacc
tcggccaagttctcggccaagtggtacgagctggacatcggctggggctatatcagcatc
ctgaagttcttcggcctggccaaggtcaagaaggttgcgcccaagctgaagctggaatcg
ggcagcaagggcatcgacctgagcacgctgcaaggcgtgatcacgcaccgctacgaagtc
atggcccgctacggcgacctggtcaagcgcgccgcgcgtgaagagctgagcaagctgaag
tcctcgcgccagcaggacgccgccaattgccgctggaccacgctgcgccgcgtgcgccgc
tggctgcaccgcaacgaggaagtcctgcagcccgagcagcgcgccgaagtcgaccaggcc
atcgcccagaaccagtcgctgtcgacgctggtgcagatgcgccgcgaactcggccgtctc
tgggaaagctccagcgccagcagcgagcagctgttgcatgacctgcaggcctggtgccag
cgcgcccagcaaagcggcatcgccgggctcgagcaatttgctctgcatctgcgccgctac
gcggcatga

DBGET integrated database retrieval system