KEGG   Bordetella pertussis Tohama I: BP2009Help
Entry
BP2009            CDS       T00139                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BP2009
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BP2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2120532..2120942
Genome map
AA seq 136 aa AA seqDB search
MNAGLAWRAGALCLALAAPSAARAAAPDPVRGEQVYARCLACHALAYDRVGPRHCGLLGR
KAGSVPGFAYTQAMKDSGLTWDAATLDRFLADPLKTVPGTAMTYAGVPDAGERADLIAYL
RAAAASPACAGVATPH
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgggcctggcctggcgggccggcgcgctgtgcctggccctggccgcgccgtcg
gccgcgcgggccgcggcgcccgacccggtgcgcggcgagcaggtctacgcgcgctgcctg
gcctgccacgcgctggcctacgaccgggtggggccgcgccactgcggcctgctcgggcgc
aaggccggcagcgtgcccggtttcgcctatacgcaagccatgaaggactccggcctgacc
tgggacgccgccacgctcgaccgcttcctggccgatcccttgaagaccgtgccaggcacc
gccatgacctacgcgggcgtgccggatgcgggcgagcgcgccgacctcatcgcctacttg
cgcgcggccgccgcctcgccggcgtgcgcgggcgtggccacgccgcattag

DBGET integrated database retrieval system