KEGG   Bordetella pertussis Tohama I: BP2060Help
Entry
BP2060            CDS       T00139                                 

Definition
(RefSeq) hypothetical protein
Organism
bpe  Bordetella pertussis Tohama I
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 2666586
NCBI-ProteinID: NP_880726
UniProt: Q7VWX4
Position
2179996..2180766
Genome map
AA seq 256 aa AA seqDB search
MPIRYTPSELDQPSLSEADGIRYLHFGTEWVQGAMLIRDPARLVLEYTAQMMAWLLFLEP
PREQSIGLLGLGAGSLARFCLKHTRSPVTVVEWNPQVTAVCQMFFRLPTPQRLDVHHDDA
GAWVADPARAGDCPVLMVDLYDAQARGPVRDSVKFYRDCRRVLGEVGVLSVNLFGRHESY
GRNIDNLSKAFDDRLVLLPEIDAGNQIVLAFSGPPLAITPAELLARAETVEAQYGLPARR
WARALTRHAVDGVLHF
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcctattcgctacaccccctcagaactcgaccaaccttcgctgtccgaagccgacggc
atccgttatctgcatttcggcaccgagtgggtgcagggcgcgatgctgatccgcgacccg
gcccggctggtgctcgagtacaccgcccagatgatggcctggctgctttttctcgagccg
ccgcgcgaacaatccatcggcctgctcggcctgggcgcggggtcgctggcgcggttctgc
ctcaagcacacgcgcagcccggtgacggtggtcgaatggaacccccaggtcaccgcggtc
tgccagatgtttttccgcctgcccacgccgcagcgcctggacgtgcatcatgacgatgcc
ggcgcctgggtggccgaccctgcgcgcgccggcgattgcccggtgctcatggtcgatctc
tacgacgcgcaggcgcgcggcccggtgcgcgattcggtcaagttctaccgcgattgccgc
cgtgtgctgggcgaggtgggcgtgctgtcggtcaacctgttcggccgccacgagagctac
gggcgcaacatcgacaacctgagcaaggctttcgacgaccgcctggtgctgctgcccgag
atcgacgcgggcaaccaaatcgtgctggcgttttccggcccgccgctggccatcaccccg
gccgaactgctggcgcgcgccgaaaccgtcgaggcgcagtacgggttgccggcgcgtcgc
tgggcgcgggcattgacccgccacgcggtcgacggcgtgctgcacttctga

DBGET integrated database retrieval system