KEGG   Bordetella pertussis Tohama I: BP2062Help
Entry
BP2062            CDS       T00139                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BP2062
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BP2062
Enzymes [BR:bpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     BP2062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2181595..2182896
Genome map
AA seq 433 aa AA seqDB search
MSALDPQASARVARTPDAEPEAVDASAAGESAGLIARLGRLFERDRLPPPADLAQLFEAR
LTDVRANKLAQAWRLAYEQADGKRRRAMLGGLAQVGAGMQGDGAQGTRLFKRFNALPDGL
RFLVALRADMLRWRKQVAGLQALDKELEALLSAWFDVGLLELRPLTWDSPASLLEKLILY
EAVHEIRSWDDLRHRVAGDRRCYAYFHPQMPDVPLIFVEVAFSAQMADNVQALLDTSAPP
QDLDKARWAIFYSISNTQPGLRGISFGNFLLKRVIDRLLQELPKLKFFATLSPIPGFVDW
LSRLDAQEVEQAVRDKARTRSGAPDGARWVARLARAATGKPSEVVQRAGLRLAARYLQAM
RAGQPLDPVARFHLGNGARIERLNWAADTSAKGLAQSCGMMVNYLYELGELDGNLARLNE
GKPQVSRGIARLG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcactcgatccccaggcatccgcacgcgtcgcacgcacgcctgacgccgaaccg
gaggcggtcgacgcatcggccgccggcgaaagcgccggcctgatcgcccggctgggccgg
ctgttcgagcgagacaggctgccgccgccggccgacctggcgcaattgttcgaggcgcgc
ctgaccgatgtgcgcgccaacaagctggcgcaggcctggcgcctggcctacgagcaggcc
gacggcaagcggcgccgcgccatgctgggcgggctggcgcaggtcggcgccggcatgcag
ggcgacggcgcgcagggcacgcgcctgttcaagcggttcaatgccttgcccgacggactg
cgtttcctggtggcgctgcgcgccgacatgctgcgctggcgcaagcaggtcgccggactg
caggccctggacaaggagctggaggcgctgctgtcggcctggttcgacgtgggcctgctg
gagctgcgcccgctgacctgggactcgcctgcctcgctgctcgagaagctgatcctctac
gaagccgtgcacgaaatccgctcgtgggacgacctgcgccaccgggtggcgggcgaccgg
cgctgctatgcgtatttccatccgcagatgccggatgtgccgctgatcttcgtggaggtg
gcgttttcggcccagatggccgacaacgtccaggcgctgctcgacaccagcgcgccgccg
caggacctggacaaggcgcgctgggcgatcttctattccatctcgaatacgcagcccggc
ctgcgcgggatcagcttcggcaacttcctgctcaagcgcgtgatcgaccgcctgctgcag
gaactgcccaagctgaaattcttcgccacgctgtcgcccatccccggtttcgtcgactgg
ctgtcgcggctggacgcgcaggaggtcgagcaggcggtgcgcgacaaggcgcgcacgcgc
agcggcgcgccggacggcgcgcgctgggtggcgcggctggcgcgcgcggccacgggcaaa
ccgtcggaagtggtgcagcgcgcgggcctgcgcctggccgcgcgctacctgcaggcgatg
cgggccggccagccgctcgatccggtggcccgtttccatctgggcaacggcgcgcgcatc
gagcgcctgaactgggccgccgacacctcggccaaggggctggcgcagtcctgcggcatg
atggtgaactacctctacgaactgggcgagctggacggcaacctggcccgcctgaacgaa
ggcaagccgcaagtcagccgcggcatcgcgcgcctgggatga

DBGET integrated database retrieval system