KEGG   Bordetella pertussis Tohama I: BP2081Help
Entry
BP2081            CDS       T00139                                 

Gene name
uvrC
Definition
(RefSeq) excinuclease ABC subunit C
  KO
K03703  excinuclease ABC subunit C
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    BP2081 (uvrC)
DNA repair and recombination proteins [BR:bpe03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     BP2081 (uvrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrC_HhH_N GIY-YIG UVR HHH_5 HHH_2 HHH DRTGG
Motif
Other DBs
NCBI-GeneID: 2667193
NCBI-ProteinID: NP_880743
UniProt: Q7VWV7
Position
2201949..2203778
Genome map
AA seq 609 aa AA seqDB search
MPDDFNLKSFLADLPHLPGVYRHLDAAGEAMYVGKARDLKKRVSSYFQKNLASPRIAQMV
AKVASVDVTVTRSEAEALLLENNLIKSLRPRYNILFRDDKSYPYLLITGHAWPRIAYYRG
ATSKRGQYFGPYPNSWAVRETIQILQKVFRLRTCEDTVFANRSRPCLLHQIGRCSAPCVG
VIEAEDYAHDVQRAVRFLNGEAREVMDEIEARMLQASTELRFEEAAVLRDQMGSLSKVLH
QQTMENVGGDDTDVIAVASAGGKICVNLAMVRGGRHLGDKPFFPTHAEGEQPAQVLEAFV
AQHYADGAMPPVLVCSHALPDSGLVGLLAEQGGTRVARVLTRPQGVRRSWLEQAQKNAEM
ALARALTESGARAGRTLALAEALDLDTDEESLDALRIECFDISHTAGEATQASCVVFLHH
DMQPSLYRRYNIVGITPGDDYAAMRQVLTRRFGKVTDGEAPMPGLVLIDGGKGQVEVARQ
VFVELGLDIQSLVGVAKGEGRKVGLETLVFADGRPPVALGKESAALMLIAQVRDEAHRFA
ITGMRARRAKTRNVSRLEEIEGIGARRRQRLLARFGGLSGVSSASIEDLASVEGISQELA
VRIYDALHG
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacgacttcaatctcaaatcgtttctggctgacctgccgcacctgcccggcgtg
taccggcatctcgatgccgccggggaggcgatgtatgtcggcaaggcgcgcgatctcaag
aaacgcgtatcgtcgtatttccagaagaacctggccagcccgcgcattgcgcagatggtg
gccaaggtggccagcgtggacgtcaccgtcacgcgttcggaggccgaggcgctgctgctc
gagaacaacctcatcaagagcctgcggccgcgctacaacatcctgttccgcgacgacaag
tcgtatccctatctgctgatcaccggccacgcgtggccgcgcatcgcgtattaccgcggc
gccaccagcaagcgggggcagtacttcggcccgtaccccaattcgtgggccgtgcgcgag
accatccagatcctgcagaaagtgttccgcctgcgcacctgcgaggacacggtcttcgcc
aatcgctcgcgtccctgtctgctacaccagatcggccgttgttcggcgccgtgcgtgggc
gtgatcgaggccgaggactacgcccacgacgtgcagcgcgccgtgcgctttctcaacggc
gaggcgcgcgaagtcatggacgagatcgaagcccgcatgctgcaggcctcgaccgagctg
cgcttcgaggaagcggcggtgctgcgcgaccagatgggctcgctgtccaaggtgctgcac
cagcagaccatggaaaacgtcggcggcgacgacaccgatgtgatcgccgtggcgtcggcc
ggcggcaagatctgtgtcaacctggccatggtgcgcggcgggcgccacctgggcgacaag
ccgttctttcccacgcatgccgagggcgagcagccggcccaggtgctggaggccttcgtg
gcgcagcattacgccgacggcgccatgccgcccgtgctggtctgttcgcacgcgctgccc
gacagcggcctggtcggcctgctggccgagcagggcggcacccgcgtggcccgggtgctg
acccgtccgcagggcgtgcgccgctcatggctggagcaggcgcagaaaaacgccgagatg
gcgctggcgcgggcactgaccgaatcgggcgcgcgcgccgggcgcaccctggcgctggcc
gaggcgctggatctcgataccgacgaggagtcgctcgatgctttgcgcatcgaatgcttc
gatatcagccacaccgccggcgaagcgacgcaggcctcgtgcgtggtgttcctgcatcac
gacatgcagccgtcgctgtatcgccgttacaacatcgtgggcattaccccgggcgacgat
tatgcggcgatgcggcaggtgctgacgcgccgcttcggcaaggtgaccgacggcgaggcg
cccatgccggggctggtgctaatcgacggcggcaagggccaggtcgaggtggcccgccag
gtgttcgtcgaactcgggctggacatccagtccctggtgggggtggccaagggggagggc
cgcaaggtggggctggaaaccctggtgttcgccgacgggcggccgcccgtcgcgctgggc
aaggaatcggcggccctgatgctgattgcgcaggtgcgcgacgaggcgcaccgctttgcc
atcaccggcatgcgcgcgcgccgcgccaagacgcgcaatgtctcgcgcctggaagaaatc
gaagggatcggggcgcgccggcgccagcggctgctggcgcgctttggcggcctgtcgggc
gtcagttcggccagcatcgaagacctggcttcggtcgagggtatttcgcaggaattggcc
gtgcgcatctatgatgcgctgcatggctga

DBGET integrated database retrieval system