KEGG   Bordetella pertussis Tohama I: BP2085Help
Entry
BP2085            CDS       T00139                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bpe01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bpe00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2206955..2208277
Genome map
AA seq 440 aa AA seqDB search
MSNRETEIRNLQKDWAENTRWQGIKRAYSAEDVIRLRGSVAVEHSLARRGATRLWDSLHS
EPFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANLAGEMYPDQSLYPANSVPQVVR
RINNALARCDQIQWMEGKNPGDQDYIDYYAPIVADAEAGFGGVLNAFELMKAMIEAGAAG
VHFEDQLASVKKCGHMGGKVLVPTREAVSKLVSARLVADVMGTPTILLARTDADAADLVT
SDVDENDRPFITGERTVEGFFRTRAGLDQAISRGLAYAPYADLIWCETSTPNLEYARKFA
EAVHRQFPGKLLAYNCSPSFNWKKNLDDGTIAKFQRELGAMGYKFQFITLAGFHALNYGM
FELAHGYARRQMSAFVELQQKEFAAAELGFTAVKHQREVGTGYFDAVTQTIEGGQSSTTA
LTGSTEEVQFEQGGQAVKAA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcgcgaaaccgaaatccgcaacttgcagaaagactgggccgagaacacccgc
tggcagggcatcaagcgcgcctacagcgccgaggatgtgatccgcctgcgcggctcggtg
gccgtcgagcattcgctggcgcgccgcggcgcgacccgcttgtgggattcgttgcatagc
gagcccttcgtcaattcgctgggcgcgttgaccggcaaccaggccatgcagcaggtcaag
gccggcctgaaggccatctacctgtccggctggcaggtggccggcgacgccaacctggcc
ggcgagatgtacccggaccagtcgctgtaccccgccaactcggtgccgcaggtggtgcgc
cggatcaacaacgccctggcgcgttgcgaccagatccagtggatggaaggcaagaacccg
ggcgaccaggattacatcgattactacgcgcccatcgtggccgatgccgaggccggtttc
ggcggcgtgctcaacgccttcgaactgatgaaggccatgatcgaggcgggcgcggctggc
gtgcacttcgaagaccagctggcttcggtgaagaagtgcggccacatgggcggcaaggtg
ctggtgccgacccgcgaggctgtgtccaagctggtctcggcccgcctggtcgccgacgtg
atgggcacgcccaccatcctgctggcccgcaccgacgccgacgcggccgacctggtgacc
agcgacgtggatgagaacgatcgcccgttcatcaccggcgagcgcacggtggaaggcttc
ttccgcacccgcgccggcctggaccaggcgatttcgcgcggcctggcctacgcgccgtat
gccgacctgatctggtgcgaaacctccacgcccaacctggagtatgcgcgcaagttcgcc
gaggccgtccatcgccagttcccgggcaagctgctggcgtacaactgctcgccctcgttc
aactggaagaagaacctggacgacggcacgatcgccaagttccagcgcgaactcggtgcg
atgggctacaagttccagttcatcacgctggccggcttccacgcgctgaactacggcatg
ttcgaattggcgcacggctatgcgcgccgccagatgagcgctttcgtggaattgcagcag
aaggagttcgccgccgccgaactgggctttaccgcggtcaagcaccagcgcgaagtcggc
accggctacttcgacgccgtgacccagaccatcgaaggcggccaatcctcgaccacggcc
ctgaccggctcgaccgaggaagtgcagttcgagcagggcgggcaggccgtcaaggcggcg
tga

DBGET integrated database retrieval system