KEGG   Bordetella pertussis Tohama I: BP2087Help
Entry
BP2087            CDS       T00139                                 

Definition
(RefSeq) transposase
Organism
bpe  Bordetella pertussis Tohama I
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve LZ_Tnp_IS481 rve_3 HTH_23 HTH_28 HTH_29 HTH_32 HTH_38 HTH_31 MarR_2 Sigma70_r4_2 Sigma70_r4 HTH_24 HTH_3 HTH_Crp_2 YdaS_antitoxin HTH_Tnp_ISL3 Trp_repressor LacI Fe_dep_repress HTH_5 HTH_IclR HTH_11 SpoIIID HTH_AsnC-type RepB HTH_Tnp_1 GntR HTH_10 Crp HTH_35 UPF0175 HTH_Tnp_4 HTH_36 HTH_37 DDE_Tnp_IS240 MarR DUF746 HTH_Tnp_Tc3_2
Motif
Other DBs
NCBI-GeneID: 2665446
NCBI-ProteinID: NP_880748
UniProt: Q7TTA1
Position
complement(2209232..2210182)
Genome map
AA seq 316 aa AA seqDB search
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADA
SSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEP
AEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVA
FTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRF
TRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWQRPHQGIGRAVP
ISRLNLDEYNLLTVHT
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaacacccataagcatgcccgattgaccttcctacgtcgactcgaaatggtccagcaa
ttgatcgcccatcaagtttgtgtgcctgaagcggcccgcgcctatggggtcaccgcgccg
actgtgcgcaaatggctgggccgcttcctggctcagggccaggcgggcttggccgatgcg
tcctcgcgcccgacggtctcgccccgagcgattgcgccggccaaggcgctggctatcgtg
gagctgcgccgcaagcggctgacccaagcgcgcatcgcccaggcgctgggcgtgtcagcc
agcaccgtcagccgcgtcctggcccgcgccggtctgtcgcacctggccgacctggagccg
gccgagccggtggtgcgctacgagcatcaggcccccggcgatctgctgcacatcgacatc
aagaagctgggacgtatccagcgccctggccaccgggtcacgggcaaccgacgcgatacc
gttgagggggccggctgggacttcgtcttcgtggccatcgatgaccacgcccgcgtggcc
ttcaccgacatccaccccgacgagcgcttccccagcgccgtccagttcctcaaggacgca
gtggcctactaccagcgcctgggcgtgaccatccagcgcttgctcaccgacaatggctcg
gcctttcgcagccgcgccttcgccgcgctgtgccatgagctgggcatcaagcaccgcttt
acccgaccttaccgcccacagaccaatggcaaggccgaacgcttcatccagtcggccttg
cgtgagtgggcttacgctcacacctaccagaactcccaacaccgagccgatgccatgaaa
tcctggctacaccactacaactggcagcgaccccaccaaggcatcgggcgcgctgtaccc
atctccagactcaacctggacgaatacaacctattgacagttcacacctag

DBGET integrated database retrieval system