KEGG   Bordetella pertussis Tohama I: BP2097Help
Entry
BP2097            CDS       T00139                                 

Definition
(RefSeq) esterase
Organism
bpe  Bordetella pertussis Tohama I
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 DLH Thioesterase Abhydrolase_1 Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 2666999
NCBI-ProteinID: NP_880757
UniProt: Q7VWU4
Position
complement(2218368..2219243)
Genome map
AA seq 291 aa AA seqDB search
MTARDPLAAIRARLAEVTACWQAAESLAQIRASFADYLAEVGPRGAAMARPRPQPLAPAL
AGAWIGQGARRALYCHGGGFQIGGIASHASLIARLAEAGQARILAVEYRLAPEHRYPAAI
DDAFAAYQWLLANGGAPAAIIGDSAGGALALQTAQRARDAGLPLPRSLVLLSPWLDLSMQ
GRSYVELAEQDIFSKPAQLRAMARSYLGHLGPPPASPLWDDLSGLPPIVVHAGAHDITLD
DSHTLAARVRAAGGQVQLQVFPGMCHHFQIYEALAEAQESIDALGRHLRQD
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcgcgatccgctggccgccatccgcgcccgcctggccgaggtcacggcctgc
tggcaggcggccgagtcgctggcgcagatccgcgccagcttcgccgactacctggccgag
gtggggccgcgcggcgcggcgatggcccgcccccggccccaacccctggcgccggcgctg
gccggcgcctggatcggccagggtgcgcggcgcgcgctgtactgccatggcggcggtttc
cagatcggcggcatcgcctcgcacgccagcctgatcgcccggctggccgaggccggccag
gcccgcatcctggccgtcgagtaccggctcgcgcccgaacaccgctatccggcggcgatc
gacgacgccttcgcggcctaccagtggctgctggccaacggcggcgcgccagcggccatc
atcggcgactccgcgggcggcgccctggcgttgcagaccgcgcagcgcgcgcgcgatgcc
ggcctgccgctgccgcgctccctcgtgctgctctccccctggctcgatctgtccatgcaa
ggccgcagctacgtggagctggccgaacaggacattttctccaagccggcacagctgcgc
gcgatggcgcgcagctatctgggacacctcggcccgccgccggcctcgccgctctgggac
gatctgtcaggcttgccgcccatcgtcgtgcacgccggcgcgcacgacatcacgctggac
gactcgcatacgctggccgcacgcgtgcgcgccgccggcgggcaggtgcaactgcaggtc
tttcccggcatgtgccatcacttccagatctacgaagcgctggccgaagcgcaggagtcg
atcgacgcgctgggccgccatctgcggcaggactag

DBGET integrated database retrieval system