KEGG   Bordetella pertussis Tohama I: BP2109Help
Entry
BP2109            CDS       T00139                                 

Definition
(RefSeq) membrane protein
  KO
K09943  uncharacterized protein
Organism
bpe  Bordetella pertussis Tohama I
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BIV_Env DUF3273 DUF2214 DUF3040 Fig1
Motif
Other DBs
NCBI-GeneID: 2666208
NCBI-ProteinID: NP_880768
UniProt: Q7VWT4
Position
2232223..2232669
Genome map
AA seq 148 aa AA seqDB search
MTYPILLALHLLAAFVFIGTVFFEVLILESVRRQVPREAMNAVERGIGNRARAIMPWVLL
ALFGAGIGMAWQHRGALEQPLASSFGLLLSLKIVLALSVLGHFAAAMRWRRRGQLRGRRS
RRLHLSVFCHVVAIVLLAKGMYYIDALR
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgacctaccccatcctgctggccctgcacctgctggccgccttcgtcttcatcggcacc
gtcttcttcgaagtcctcatcctcgaaagcgtgcggcggcaagtgccgcgcgaagccatg
aacgcggtcgagcgcggcatcggcaaccgcgcccgcgccatcatgccatgggtgctgctg
gcgctgttcggcgccggcatcggcatggcctggcagcaccgcggcgcgctcgaacagccg
ctggccagcagcttcggcctgctactcagcctgaagatcgtgctggcgctcagcgtcctg
ggccatttcgccgccgccatgcgctggcgccggcgcggccaattgcgcggccggcgttcg
cggcggctgcacctgagcgtgttctgccacgtcgtggcgatcgtgttgctggccaagggg
atgtactacatcgacgcgttgcgctga

DBGET integrated database retrieval system