KEGG   Bordetella pertussis Tohama I: BP2115Help
Entry
BP2115            CDS       T00139                                 

Definition
(RefSeq) hypothetical protein
Organism
bpe  Bordetella pertussis Tohama I
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_deac_1 DUF2334 Exc
Motif
Other DBs
NCBI-GeneID: 2666321
NCBI-ProteinID: NP_880773
UniProt: Q7VWS9
Position
complement(2238465..2239319)
Genome map
AA seq 284 aa AA seqDB search
MAAKQSLVCLTFDFDAISVWLARGMDSPTPVSRGEFCAVAADRVLDLLERLGLPSTWFIP
GHTLASYPEHCRRVHEAGHEIGHHGWTHVAPNLMTREEELDGLVRANEAIRALTGRVARG
YRSPSWDLSPHTLALLLEHGFDYDSSMMGHDYQPYPVRQGDSFPLDEPAVFGAPTRLIEV
PVSWSLDDYPHFEFVRAGQSVIPGLMNANSVMDNWIEDFLYLKENFDWGVITYTFHPFVI
GRGHRMRMLERLLRRLIDEGATFVRMEEAVDAYRQRQALAAGAA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaaacaatccctggtttgcctgaccttcgatttcgacgcgatctcggtgtgg
ctggcgcgcggcatggacagtccgacgccggtgtcgcgcggcgagttctgcgccgtggcg
gccgaccgcgtgctggacttgctcgaacggctgggcctgccgtcgacctggttcatcccc
ggccataccttggccagctatccggagcattgccggcgcgtgcacgaggccggccatgaa
atcggccaccacggctggacgcacgtcgcgcccaacctgatgacgcgcgaggaagagctc
gacggcctggtgcgcgcgaacgaggcgatccgcgcgctgacggggcgggtcgcgcgcggc
taccgctcgccatcgtgggacctcagtccgcacaccctggcgctgctgctcgagcacggc
ttcgactacgacagcagcatgatggggcacgactatcagccgtatccggtgcgccaggga
gacagttttcccctggacgaacccgcggtgttcggcgcgcccacccgcctgatcgaggtg
cctgtcagctggtcgctggacgactatccgcacttcgagttcgtgcgcgccgggcagagc
gtcatccccggcctgatgaatgccaacagcgtgatggacaactggatcgaggacttcctg
tacctgaaggagaacttcgactggggcgtcatcacctacaccttccatcctttcgtgatc
ggccgcggccaccgcatgcgcatgctcgagcgcctgctgcggcgcctgatcgacgagggc
gcgacgttcgtgcgcatggaggaagcggtggacgcgtaccggcaacggcaggcgctggcc
gccggcgccgcatga

DBGET integrated database retrieval system