KEGG   Bordetella pertussis Tohama I: BP2161Help
Entry
BP2161            CDS       T00139                                 

Definition
(RefSeq) integral membrane protein
Organism
bpe  Bordetella pertussis Tohama I
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LrgA
Motif
Other DBs
NCBI-GeneID: 2666656
NCBI-ProteinID: NP_880811
UniProt: Q7VWP4
Position
complement(2282984..2283343)
Genome map
AA seq 119 aa AA seqDB search
MQALTGFTWLLALQALGEACSRLLHFPIPGPVTGMLLLLVALRWPPVREPVALAAQFLLS
HLSLLFVPVGVGVMTHIALLAEYGLRMAAVIVLSTLAGMAATYWALRVGRSATPEADDA
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccctgaccggattcacctggctgctggccctgcaggcgctgggcgaagcctgc
tcgcgcctgctgcactttcccattcccggcccggtgaccggcatgttgctgctgctggtg
gcgctgcgctggccgccggtgcgcgagccggtggcgctggcggcgcagttcctgctgtcg
cacctgtcgctgctgttcgtgccggtcggcgtgggcgtcatgacccatatcgcgctgctc
gccgagtacggcctgcgcatggcggccgtgatcgtgctgtcgacgctggccggcatggcg
gccacgtactgggcgctgcgcgtgggcaggagcgcaacgccggaggccgacgatgcctga

DBGET integrated database retrieval system