KEGG   Bordetella pertussis Tohama I: BP2178Help
Entry
BP2178            CDS       T00139                                 

Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bpe  Bordetella pertussis Tohama I
Module
bpe_M00254  ABC-2 type transport system
Brite
Transporters [BR:bpe02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    BP2178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_23 AAA Hydrolase SMC_N DUF4162 AAA_29 ATPase AAA_15 AAA_16 TsaE RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 2666001
NCBI-ProteinID: NP_880827
UniProt: Q7VWM9
Position
2297155..2298078
Genome map
AA seq 307 aa AA seqDB search
MQAVISVQGLSKTYASGHPALKNINLDIYRGEIFALLGPNGAGKTTLISIICGIVNPGSG
RVLADGHDIVREFRAARDAIGLVPQELTTDAFETVWNTVSFSRGLFGKPADPALIERILR
DLSLWDKKDSRIMALSGGMKRRAMIAKALSHEPRILFLDEPTAGVDVELRHGMWQMVRRL
RENGVTIILTTHYIEEAQEMADRIGVIRKGEIILVEDKHALMSKLGKKQLVIMLDAPLAA
LPALAGDYQLELAAEGTQLVYTYDNQVSGGIAALLRELDARGIGFHDLQSSESSLEDIFV
SLVSAQT
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagcagtcatctccgtgcaaggcctgtccaagacgtatgcgtcagggcatcccgcg
ctgaagaacatcaacctggatatctaccgcggcgaaatattcgcgctgctcggccccaac
ggcgccggcaagaccacgctgatcagcatcatctgcggcatcgtcaatccgggcagcggg
cgtgtgctggccgacggccacgacatcgtgcgcgagttccgcgccgcgcgcgacgccatc
ggcctggtgccgcaggaactcaccaccgacgcgttcgagacggtctggaacacggtcagc
ttcagccgcggcctgttcggcaagccggccgacccggcgctcatcgaacgcattctgcgc
gacctctcgctgtgggacaagaaggacagccgcatcatggcgctgtccggcggcatgaag
cggcgcgccatgatcgccaaggcgctgtcgcacgagccgcgcatcctgttcctggacgag
ccgaccgccggcgtggacgtcgaactgcgccacggcatgtggcagatggtgcggcggctg
cgcgaaaacggcgtcaccataatcctgaccacgcactacatcgaggaagcccaggagatg
gccgatcgcatcggcgtcatccgcaagggtgagatcatcctggtcgaggacaagcacgcg
ctgatgagcaagctgggcaagaagcagctcgtcatcatgctggatgcgccgctggccgcg
ctgccggcgctggccggcgactaccagctcgaactggccgccgagggcacgcagctggtc
tatacctacgacaaccaggtcagcggcgggatcgccgcgctgctgcgcgagctggacgcg
cgcggcataggctttcacgacctgcaatcgtccgagagctccctcgaggatatcttcgtc
agcctggtgagtgcgcaaacatga

DBGET integrated database retrieval system