KEGG   Bordetella pertussis Tohama I: BP2362Help
Entry
BP2362            CDS       T00139                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:bpe01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bpe00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bpe00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:bpe00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(2501374..2501757)
Genome map
AA seq 127 aa AA seqDB search
MADTKNYGPKRLVVGAHYGVTDFIAQRITAVILAVYTLVLIVGLLIMPAFTYENWKALFT
FHVFALPVGQILASLAFFALAWHAWIGVRDIWMDYVRPVGVRLLLQVLTILWLVGSVVYF
AQILWRI
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggccgatacgaaaaactatggccccaagcgcctggtcgtcggcgcccactacggggtt
accgatttcatcgcccagcgcatcaccgccgtcatcctggccgtgtataccctggtgctg
atcgtcggcctgctgatcatgccggctttcacgtatgaaaactggaaggccctgttcacc
ttccacgtgttcgcccttccggtgggccagatcctggcctcgctcgctttctttgcgctg
gcctggcatgcctggatcggcgtgcgcgacatctggatggactatgtccgcccggtaggc
gtgcgcctgctgctgcaggtgctgaccatcctctggctggtcggttcggtcgtctacttc
gcgcaaatcctctggagaatctaa

DBGET integrated database retrieval system