KEGG   Bordetella pertussis Tohama I: BP2377Help
Entry
BP2377            CDS       T00139                                 

Definition
AMP-binding protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bpe01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bpe00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bpe00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bpe00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bpe00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2516240..2517931
Genome map
AA seq 563 aa AA seqDB search
MPPSSDHRAMNDQYEALYQTFRWLVPTQFNIADACCHRWAASSPDARRIAIYYEDEAGNR
EVWTYARLAEAANQLANGLVKMGVERGDRVGVVLGQRPETVVAHMAIYSVGAVVLPLSPL
FGPEALESRLRDADARVAIVDYASSANLLAISDNCPNLHQIIGIGFADERVLPWRSLLAR
QPNEFKMVATRASDPAILMYTSGTTGAPKGALLPHSVLIGNLPGFVASQDWFPRPGDVFW
SPADWAWTGGMMDALLPTLYFGHPIVGTRGRFTPERAFELMERYQVTNTFLFPTALKMMM
KSVPEPRGRYQLALRSIMSAGESVGETVFEWCEQALGITPNEMFGQTELNYVVGNSNRRW
PARPGSMGRPYPGHRVAVIDEAGRPVKPGETGEVALNRFDIHGFPDPVLFLGYWRNEAAT
AAKFTDDWCRTGDLASIDADGYLWYAGRADDVFKSAGYRIGPGEIENCLLGHPAVANAAV
VPKPDAERGALVKAYVVLTPEYQGRDPDSITQVLQEHVRDRLAPYEYPKEIEYVDALPMT
TTGKIQRAVLRRREAERASGAHS
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
ttgccaccgagctcagaccatagggccatgaacgaccaatacgaggcgctgtaccaaacc
ttccgctggctggttccgacccagttcaatatcgcggacgcctgctgccaccgctgggcc
gccagcagtccggacgcacgccgtatcgccatctactacgaagacgaagcgggcaaccgc
gaggtctggacctacgcgcgcctggccgaagccgccaaccagctggccaatggcctggtg
aagatgggcgtggagcgcggcgaccgcgtgggtgtggtattgggacaacgtccggagacc
gtcgtcgcccacatggcgatctacagcgtcggcgccgtggtactgccgctgtcgcccctg
ttcggcccggaggcgctcgaatcgcgcctgcgcgacgccgacgcgcgggtggccatcgtg
gactacgcctccagcgccaacctgctggccatcagcgacaactgccccaacctgcaccag
atcatcggcatcggcttcgccgacgagcgggtgctgccctggcgcagcctgctggcgcgc
cagccgaacgaattcaagatggtggccacgcgcgcgtccgacccggccatcctgatgtac
acgtccggcaccaccggcgcccccaagggcgcgctgctgccgcacagcgtgctgatcggc
aacctgcccggcttcgtcgcgtcccaggactggtttccccggcccggcgacgtcttctgg
tcgccggcggactgggcctggaccgggggcatgatggacgccctgctgccgaccctgtat
ttcggccaccccatcgtcggcacgcgcgggcgctttacgccggaacgcgccttcgagctg
atggagcgctaccaggtcaccaataccttcctgttcccgaccgcgctgaagatgatgatg
aagtcggtgcccgagccgcgcggccgctaccagctggcgctgcgcagcatcatgagcgcc
ggcgaaagcgtgggcgaaaccgtgttcgagtggtgcgagcaggcgctgggcatcacgccc
aacgagatgttcggccagaccgagctgaactacgtggtgggcaacagcaaccggcgctgg
ccggcgcgccccggcagcatgggccggccctatccgggccatcgggtcgccgtcatcgac
gaagcgggccggccggtcaagcccggcgaaacgggcgaagtggcgctcaaccggttcgat
atccacggcttccccgatccggtgctgttcctgggctactggcgcaacgaggctgcgacc
gccgcgaagttcacggacgattggtgccgcaccggcgacctggccagcatcgacgccgac
ggctacctctggtatgccggacgggccgacgatgtgttcaagtcggccggctaccggatc
ggcccgggcgagatcgagaactgcctgctgggccatcccgcggtagccaatgcggcggtc
gtgcccaagcccgacgccgaacgcggcgccctggtcaaggcctatgtggtgctgacgccc
gagtaccagggccgcgacccggacagcatcacccaggtgctgcaggagcacgtgcgcgac
cgcctggctccctacgaataccccaaggaaatcgaatacgtcgatgccttgcccatgacc
actaccggaaaaatccagcgcgccgtactgcgccgccgcgaggccgaacgcgccagcggc
gctcactcctga

DBGET integrated database retrieval system