KEGG   Bordetella pertussis Tohama I: BP2377Help
Entry
BP2377            CDS       T00139                                 

Definition
AMP-binding protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BP2377
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP2377
   00620 Pyruvate metabolism
    BP2377
   00640 Propanoate metabolism
    BP2377
  Energy metabolism
   00680 Methane metabolism
    BP2377
Enzymes [BR:bpe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BP2377
Lipid biosynthesis proteins [BR:bpe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BP2377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2516240..2517931
Genome map
AA seq 563 aa AA seqDB search
MPPSSDHRAMNDQYEALYQTFRWLVPTQFNIADACCHRWAASSPDARRIAIYYEDEAGNR
EVWTYARLAEAANQLANGLVKMGVERGDRVGVVLGQRPETVVAHMAIYSVGAVVLPLSPL
FGPEALESRLRDADARVAIVDYASSANLLAISDNCPNLHQIIGIGFADERVLPWRSLLAR
QPNEFKMVATRASDPAILMYTSGTTGAPKGALLPHSVLIGNLPGFVASQDWFPRPGDVFW
SPADWAWTGGMMDALLPTLYFGHPIVGTRGRFTPERAFELMERYQVTNTFLFPTALKMMM
KSVPEPRGRYQLALRSIMSAGESVGETVFEWCEQALGITPNEMFGQTELNYVVGNSNRRW
PARPGSMGRPYPGHRVAVIDEAGRPVKPGETGEVALNRFDIHGFPDPVLFLGYWRNEAAT
AAKFTDDWCRTGDLASIDADGYLWYAGRADDVFKSAGYRIGPGEIENCLLGHPAVANAAV
VPKPDAERGALVKAYVVLTPEYQGRDPDSITQVLQEHVRDRLAPYEYPKEIEYVDALPMT
TTGKIQRAVLRRREAERASGAHS
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
ttgccaccgagctcagaccatagggccatgaacgaccaatacgaggcgctgtaccaaacc
ttccgctggctggttccgacccagttcaatatcgcggacgcctgctgccaccgctgggcc
gccagcagtccggacgcacgccgtatcgccatctactacgaagacgaagcgggcaaccgc
gaggtctggacctacgcgcgcctggccgaagccgccaaccagctggccaatggcctggtg
aagatgggcgtggagcgcggcgaccgcgtgggtgtggtattgggacaacgtccggagacc
gtcgtcgcccacatggcgatctacagcgtcggcgccgtggtactgccgctgtcgcccctg
ttcggcccggaggcgctcgaatcgcgcctgcgcgacgccgacgcgcgggtggccatcgtg
gactacgcctccagcgccaacctgctggccatcagcgacaactgccccaacctgcaccag
atcatcggcatcggcttcgccgacgagcgggtgctgccctggcgcagcctgctggcgcgc
cagccgaacgaattcaagatggtggccacgcgcgcgtccgacccggccatcctgatgtac
acgtccggcaccaccggcgcccccaagggcgcgctgctgccgcacagcgtgctgatcggc
aacctgcccggcttcgtcgcgtcccaggactggtttccccggcccggcgacgtcttctgg
tcgccggcggactgggcctggaccgggggcatgatggacgccctgctgccgaccctgtat
ttcggccaccccatcgtcggcacgcgcgggcgctttacgccggaacgcgccttcgagctg
atggagcgctaccaggtcaccaataccttcctgttcccgaccgcgctgaagatgatgatg
aagtcggtgcccgagccgcgcggccgctaccagctggcgctgcgcagcatcatgagcgcc
ggcgaaagcgtgggcgaaaccgtgttcgagtggtgcgagcaggcgctgggcatcacgccc
aacgagatgttcggccagaccgagctgaactacgtggtgggcaacagcaaccggcgctgg
ccggcgcgccccggcagcatgggccggccctatccgggccatcgggtcgccgtcatcgac
gaagcgggccggccggtcaagcccggcgaaacgggcgaagtggcgctcaaccggttcgat
atccacggcttccccgatccggtgctgttcctgggctactggcgcaacgaggctgcgacc
gccgcgaagttcacggacgattggtgccgcaccggcgacctggccagcatcgacgccgac
ggctacctctggtatgccggacgggccgacgatgtgttcaagtcggccggctaccggatc
ggcccgggcgagatcgagaactgcctgctgggccatcccgcggtagccaatgcggcggtc
gtgcccaagcccgacgccgaacgcggcgccctggtcaaggcctatgtggtgctgacgccc
gagtaccagggccgcgacccggacagcatcacccaggtgctgcaggagcacgtgcgcgac
cgcctggctccctacgaataccccaaggaaatcgaatacgtcgatgccttgcccatgacc
actaccggaaaaatccagcgcgccgtactgcgccgccgcgaggccgaacgcgccagcggc
gctcactcctga

DBGET integrated database retrieval system