KEGG   Bordetella pertussis Tohama I: BP2422Help
Entry
BP2422            CDS       T00139                                 

Definition
hypothetical protein
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BP2422
   00240 Pyrimidine metabolism
    BP2422
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BP2422
   03430 Mismatch repair
    BP2422
   03440 Homologous recombination
    BP2422
Enzymes [BR:bpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BP2422
DNA replication proteins [BR:bpe03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BP2422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2565174..2565629
Genome map
AA seq 151 aa AA seqDB search
MTRIDFAFGAPDRLRAACRTARKRFQAGQRLVVYCADGGRLAAFDRMLWALEDVSFVPHV
LANDALAADTPVLLTAGDPAAALALATTGDSRPWLLNLDDGCPPNFDGYERLLEIVSDDP
ADRQAARQRWRDYQNAGHALHSHDLSRAGEA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcatcgacttcgccttcggcgctccggaccgcctgcgcgcggcctgccgcacc
gcgcgcaagcgcttccaggcgggccagcggctggtggtctactgcgccgacggcggacgc
ctggccgccttcgaccggatgctgtgggccctggaggacgtctcgttcgtgccgcatgtg
ctggccaacgacgcgctggcggccgacacgccggtcctgctgaccgcgggcgaccccgcc
gccgccctggcgctggccaccaccggcgacagccgcccctggctgctgaacctggatgac
ggctgcccgcccaacttcgatggctacgagcgcctgctggaaatcgtctccgacgacccg
gccgaccgccaggcggcgcgccagcgctggcgcgactatcagaatgccggccatgcgctg
cacagccatgacctgagccgcgcgggcgaggcctga

DBGET integrated database retrieval system