KEGG   Bordetella pertussis Tohama I: BP2536Help
Entry
BP2536            CDS       T00139                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BP2536
Enzymes [BR:bpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BP2536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(2687563..2688351)
Genome map
AA seq 262 aa AA seqDB search
MSQIAILTRPQGRNGALAQRLHDAGWQTLCLPALRIEPLPPENGVVPLPRDYDLVVFVSG
NAARLYLEQLRERGELPWPAGAVAATVGPASARALLDSGQFGADTTVLHPAETAPTHDSE
ALWALLRARPALPRRALLVRGTQGRDWLADRLVAAGVEVSRHAVYRRRPAPWAQEGRQRL
RDWALAGERPTWLLTSGEGIDALVQGLREEQLLDWWLQGRFVVTHPVLAERLRALAGGGA
DAPMVKNCMPADEAIFATFVAA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagattgccatcctgacacggccgcaaggccgcaatggcgcgcttgcgcaacgc
ctgcacgacgccggttggcagaccctttgcctgccggccttgcgcatcgagccgttgccg
cccgaaaacggcgtggtgccgctgccgcgcgactacgacctggtggtgtttgtcagcggc
aacgcggcgcgcctgtacctggagcagctgagggagcggggcgaattgccatggccggca
ggcgcggtcgccgccaccgtgggcccggccagcgcccgcgccctgctggattcgggccag
tttggcgccgatacaacagttttgcaccccgcggaaaccgcgcccacccacgattcggaa
gccttgtgggccttgttgcgggcgcgtccggcattgccgcgccgcgcgctgctggtgcgc
ggcacgcaggggcgcgactggctggccgatcgcctggttgcggctggcgtggaggtcagc
cgccacgccgtctaccgccggcggcccgcgccctgggcgcaggaggggcgccagcgcctg
cgcgactgggccctggcgggcgagcgcccgacctggctgctcaccagcggcgagggcatc
gacgcgctggttcagggcctgcgcgaggagcaattgctggactggtggctgcagggccgt
ttcgtcgtcacgcaccccgtgctggccgagcggctgcgggcgctggccggtggcggcgcc
gatgcgccaatggtaaaaaactgcatgcctgccgatgaggcgatcttcgcgacttttgtt
gcggcttga

DBGET integrated database retrieval system