KEGG   Bordetella pertussis Tohama I: BP2541Help
Entry
BP2541            CDS       T00139                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00020  Citrate cycle (TCA cycle)
bpe00640  Propanoate metabolism
bpe00660  C5-Branched dibasic acid metabolism
bpe01100  Metabolic pathways
bpe01110  Biosynthesis of secondary metabolites
bpe01120  Microbial metabolism in diverse environments
bpe01130  Biosynthesis of antibiotics
bpe01200  Carbon metabolism
Module
bpe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BP2541 (sucC)
   00640 Propanoate metabolism
    BP2541 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BP2541 (sucC)
Enzymes [BR:bpe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BP2541 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 Cation_ATPase_N
Motif
Other DBs
NCBI-GeneID: 2666045
NCBI-ProteinID: NP_881168
UniProt: Q7VVU5
Position
complement(2692197..2693357)
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKELLKQFGVTVPRGIPAFSVDEAVAAAEKLGGPVWVVKAQIHAGGRGKGGGV
KLGRSIDEVRQLSSEILGMQLVTHQTGPQGQKVRRLLIEEGADIKKEYYVGIVTDRGTQR
VCVMASSEGGMDIEEVAAHSPEKILKVFVDPAAGLTDAEAAELARGIGVPEASVGKAAAE
FQKLYKAYWDTDASLAEINPLILTGSGDIIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYIQLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATAEKVTE
AFKIMLKNKSVKAILVNIFGGIMRCDVIAEGVITACKAVNLNVPLVVRMKGTNEELGKKM
LAESGLPIISADTMAEAATKVVAAVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccacgagtatcaaggcaaggaactgctgaagcagtttggcgtgaccgtgcca
cgcgggatccccgctttttccgtagacgaggccgtggctgccgctgaaaagctgggtggg
ccggtctgggtcgtcaaggcgcagatccacgcgggtggccgtggcaagggcggtggcgtc
aaactggggcgttcgatcgacgaagtgcgccagctgtcgtcggagatcctcggcatgcag
ctggtcacgcaccagaccggcccgcaaggccagaaagtgcgccgcctgctgatcgaagag
ggcgcggacatcaagaaggaatactacgttggcatcgtgaccgaccgtggcacgcagcgc
gtgtgcgtcatggcttccagcgaaggcggcatggacatcgaggaagtggccgcgcacagc
ccggagaagatcctgaaggtcttcgttgatccggccgccggcctgaccgacgccgaggcc
gccgaactggcgcgcggcatcggcgtgcccgaagcctccgtgggcaaggctgccgccgaa
ttccagaagctgtacaaggcgtactgggacaccgacgcctcgctggctgaaatcaacccc
ctgatcctgaccggcagcggcgacatcatcgcgctggacgccaagttcaacttcgattcg
aacgcgctgttccgccaccccgagatcgtggcctaccgtgatctggacgaggaagacccg
gccgaaatcgaagccagcaagttcgacctggcctatatccagctcgacggcaacatcggc
tgcctggtcaacggcgccggcctggccatggccaccatggataccatcaagctgttcggc
ggagagccggccaacttcctggacgtcggcggtggcgccacggccgagaaggtcaccgaa
gcattcaagatcatgctcaagaacaagagcgtgaaggcgattctggtcaacatcttcggc
ggcatcatgcgctgcgacgtgatcgccgaaggcgtgatcacggcgtgcaaggcggtcaac
ctgaatgtgccgctggtcgtgcgcatgaagggcaccaacgaagagctcggcaagaaaatg
ctggccgaatcgggcctgccgatcatcagcgccgacacgatggccgaagcggccaccaaa
gtcgttgccgccgtcaaataa

DBGET integrated database retrieval system