KEGG   Bordetella pertussis Tohama I: BP2601Help
Entry
BP2601            CDS       T00139                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BP2601
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP2601
  Lipid metabolism
   00071 Fatty acid degradation
    BP2601
  Amino acid metabolism
   00350 Tyrosine metabolism
    BP2601
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BP2601
   00626 Naphthalene degradation
    BP2601
Enzymes [BR:bpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BP2601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(2752444..2753475)
Genome map
AA seq 343 aa AA seqDB search
MKETYRAMQASRPGVLELVERRTPRPAAAEVLIRVEACGMCGADIADIEKAGPTVPPRVP
GHEVVGRIVALGGQVPPIWRLGQRVGVGRLGGHCNECDQCRQGRFQLCESQPIVGASCDG
GYAEMMLARATGLVSIPDELDAQEAAPILCAGVATFNALRKCGAQPGDLVAVVGIGGLGH
MALQYARRMGFRVVAIGRGADIATDAMALGAHAYIDNLEQNVVATLRRMGGAQAVLTTID
QAEAVSALLGALAPEGRLVVLNPGKSALQVSAGLLVGGQRSIVGSLTGTPHDNEKALNFS
VLVDARPSIEVWPLARADEAYRQLQSGAPRFRLVLAMGNTDQD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaacgtacagggcgatgcaggccagcaggcccggcgtgctggaactcgtcgag
cggcgcacgccgcgtcccgccgccgcggaagtgttgatccgggtggaggcttgcggcatg
tgcggcgccgacatcgccgatatcgagaaggccggccccaccgtgccgccccgcgtgccc
ggacacgaggtggtgggacgtatcgtggccctgggcggtcaggtgccgccgatctggagg
ctgggccagcgcgtgggcgtgggccgcctgggcggccattgcaacgagtgcgaccaatgc
cggcagggacgtttccagctttgcgagagccagccgatcgtcggcgccagttgcgatggc
ggttatgccgagatgatgctggcgcgcgccaccggactggtgtcgatcccggatgagctg
gatgcgcaggaagcggcgcccattctttgcgccggcgtggccacgttcaatgcattgagg
aaatgcggcgctcagcccggcgacctggtggccgtcgtgggcatcggcggcctggggcac
atggccttgcaatatgcgcgacgcatggggttcagggtcgtcgccatcgggcgcggtgcg
gatatcgccacggatgccatggcgctgggcgcgcatgcctacatcgacaatctcgagcag
aacgtcgtcgccacgctcaggcgcatgggaggcgcgcaggccgtcctgaccacgatcgac
caggccgaggcagtgtcggcattgcttggcgcgttggcgcccgaaggacgcctggtcgtt
ctcaacccgggcaagtctgcgttgcaggtttccgccggactgttggtcggtgggcaacgc
agtatcgtcgggtcgctcaccggcacgccccatgacaacgaaaaagcgttgaacttcagc
gtgctggtggatgcgcgcccgagcatcgaggtctggccgctggcgcgggccgacgaggcc
tacaggcagttgcaatccggcgcgcccaggttccgcctggtgctggccatgggaaatacc
gaccaagactga

DBGET integrated database retrieval system