KEGG   Bordetella pertussis Tohama I: BP3117Help
Entry
BP3117            CDS       T00139                                 

Definition
restriction endonuclease
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
bpe  Bordetella pertussis Tohama I
Brite
Enzymes [BR:bpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     BP3117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(3319969..3323088)
Genome map
AA seq 1039 aa AA seqDB search
MSDQFFAQPILNSPYEYPARHWELDTSGQPTQEIVSSRRRADFITPIPKPRKKKGEHEQA
GLLFDEGKGLSTAQQAYDHTAIINAVRQEVDAWRKLPPSQWRVTPETARLLEHWRNHKFA
GVRPFFCQVEAAETAIWLTEVAPQLGKNGERFLDHLDKASNDANPGLLRLALKLATGAGK
TTVMAMLIAWQTVNAVRHPQSKRFTRGFLLVAPGLTIKDRLRVLLPNDADSYYASREIVP
RDMLADMDKAKIVITNYHAFKLRERMELSKGGRRLLQGRTGSELDTLETEGQMLQRVMPE
LMGLKNILAINDEAHHCYREKPASDDDFIDDKGNPLTGDDLKAAKEHVKDENEAARLWIS
GLEAVNRKLGLQQVIDLSATPFFLAGSGYVEGTLFPWTMSDFSLMDAIECGIVKLPRVPV
ADNIPGAEMPIYRELWKHIGKKMPKKGRGKNAQLDPLAIPVELQTALEALYGHYRKTYEA
WKQAGINVPPCFIVVCNNTATSKLVFDYISGFERTNDDGSIMRVPGRLELFRNFDEHGEP
LARPNTLLIDSEQLESGEALDDNFRGMAADEIGRFKREIIERTGDRRQAENLSDSELLRE
VMNTVGKQGRLGEQIRCVVSVSMLTEGWDANTVTHILGVRAFGTQLLCEQVIGRALRRQS
YELNEQGLFDVEYADVFGIPFDFTAKPVVVTPPKPRETVTVKALRPERDPLEILFPRVQG
YRVELPEEQLEAEFNNDHHLTLTPDMVGATKTHNAGIIGEAVELDIKHLGDVRQSTLLME
LTKHLLFQHWRDQGQDAPIALFGQLKRIVRQWLDECLECKGGTYPAQLMYRELADTACQR
ITKGITAKELEKGRQVKAILDPFNPTGSTAHVRFNTSRPGSERWETLGVENQPKNQVNWV
ILDSGWEAEFCRVAESHPKVLAYTKNHNLGLEVPYRFGSANRIYIPDFIVQVGDGGGNND
PLNLIVEIKGYRREDAKEKKSTMDTYWIPGVNHLGTHGRWAFAEFGDVYEMQDDFAKEVE
AKFNQMIEAAVPAPGNKEN
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgatcagttcttcgcccaacccattctgaattcgccgtatgagtatccggcccgg
cattgggagctagacaccagcggtcagccgacccaggaaatcgtctccagccgccgccgc
gccgacttcatcacaccgattcccaaaccgcgcaagaagaaaggtgaacacgagcaggcg
ggtctgttgtttgatgaaggcaagggcctgtccactgctcagcaggcttatgaccacacc
gccatcatcaatgctgtccggcaggaagtggatgcctggcgtaagctacccccgtcgcag
tggcgcgtcacccctgaaacagcccgtctactggaacattggcgcaaccacaagttcgct
ggtgtgcgtccgttcttctgccaggtcgaagcggccgagaccgccatctggttgaccgag
gtcgccccgcagcttggcaagaacggcgagcgcttcctcgatcatctggataaagccagc
aacgatgccaaccctggcctgctgcgcttggcgctgaaactggccaccggggcaggcaag
accacggtcatggccatgctcatcgcttggcagacggtcaacgccgtgcgccatccgcag
agcaagagattcacccgaggcttcctgctggtcgcccctggcctgaccatcaaggatcgt
ctgcgcgtgctgctgcccaatgatgcggacagctactacgccagccgagagatcgtgccc
cgcgacatgttggcggatatggacaaggccaagatcgtcatcaccaactaccacgccttc
aaactgcgcgagcgcatggagttgtccaagggcggccgtcgcttgctgcaaggccgtact
ggcagcgagctggacacgctggaaaccgagggccagatgctccagcgggtcatgccggaa
ttgatggggctgaagaacattctcgccatcaacgacgaggcgcaccattgctatcgagag
aagcccgcttccgacgacgacttcatcgacgacaaaggtaaccccctgaccggcgatgac
ctcaaggcggccaaggaacacgtcaaggacgagaacgaagccgcgcgcctgtggatttcc
ggtctggaggcagtcaaccgcaagctgggtttgcaacaggtgatcgacctgtcggccacg
ccgttcttcctggccggttctggctacgtggaaggtacgctgtttccctggacgatgagc
gacttctcgctgatggacgccatcgaatgcggcatcgtcaaattgccgcgcgtgccggtg
gccgacaacatccccggcgcggaaatgcccatctaccgcgagctctggaagcacatcggc
aaaaagatgccgaagaaggggcggggcaagaacgcccagctcgatccgctggccatcccg
gtggaattgcagaccgcgttggaagccctgtacggccactaccgcaaaacctacgaagct
tggaaacaggccggcatcaacgtgccaccgtgcttcatcgtggtgtgcaacaacaccgcc
acttccaaactggtgttcgattacatatccggtttcgagcgcaccaacgacgacggttcc
atcatgcgcgtgccggggcggctggaactgttccgcaacttcgacgagcatggcgagccg
ctggcgcgcccgaacaccttgctgatcgacagtgagcaactagaatctggcgaggcgctg
gacgataacttccggggtatggccgctgatgagattggacgcttcaagcgcgagattatc
gagcgcaccggcgatcgccgccaggctgagaatctgagtgacagcgaactgctgcgcgag
gtgatgaacaccgttggcaagcagggccgcttgggcgagcaaatccgctgcgtggtgtcg
gtgtccatgctcacggaaggttgggatgccaatacggtgactcacatccttggtgttcgt
gcgttcggcacccagttgctgtgtgaacaggtgattggccgtgccctgcgccgccagtcc
tatgaattgaacgagcaaggcctcttcgacgtggagtatgccgacgtatttggcatcccc
ttcgacttcacagccaagccggttgtcgtcacgccgcccaagccccgcgaaaccgtcacg
gtcaaggcattgcgcccggaacgcgaccctctggaaatcctgttcccgcgcgtgcagggc
tatcgcgtcgaactgccagaagaacaactcgaagccgagttcaacaacgaccaccacctc
actctgacgccggacatggttggtgcgacaaagactcacaacgccggcatcattggcgaa
gcggtggaactggacatcaagcacctgggggatgtgcgccagtccaccctgttgatggag
ctaaccaagcacctgctgttccagcactggcgcgatcaaggccaggacgccccaattgcc
ttgttcgggcagctcaagcgcatcgtgcgccagtggctggatgagtgcctggaatgcaaa
ggcggcacctatccggcgcagttgatgtaccgcgaactggcggacacggcctgccagcgc
atcaccaagggcattaccgcaaaggaactggagaagggccggcaggtcaaggccatcctc
gacccgttcaacccgaccggcagcactgcgcatgtgcgcttcaacacctcccgcccgggc
agcgaacgctgggagaccctcggggtggagaaccagccgaagaaccaagtcaactgggtg
atcctcgacagcggctgggaagccgaattctgccgagtcgccgagtcgcatcccaaggtg
ctggcctacaccaagaaccacaaccttggactggaagtgccctaccgcttcggctcggcc
aaccgcatctacatcccggacttcatcgtgcaagtgggcgacggtggcggcaataacgac
ccgttgaacttgatcgtcgagatcaagggctaccggcgcgaggatgcgaaggagaagaag
tccaccatggacacctattggattcccggcgtgaaccacctcggcacacacggccgttgg
gccttcgccgagttcggcgatgtgtacgaaatgcaggatgactttgccaaagaggtcgaa
gcgaagttcaaccaaatgattgaagcggctgtgcccgcgccgggaaacaaggaaaactga

DBGET integrated database retrieval system