KEGG   Bordetella pertussis Tohama I: BP3270Help
Entry
BP3270            CDS       T00139                                 

Definition
thiol:disulfide interchange protein (periplasmic)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bpe  Bordetella pertussis Tohama I
Brite
Enzymes [BR:bpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BP3270
Secretion system [BR:bpe02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   BP3270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3487649..3488488
Genome map
AA seq 279 aa AA seqDB search
MSGPSFSGAGMNFRITVWCAAAAVWSSGALAQDGAGQAAPGTPDKVYSTTGSAPAKPGDK
VYSTRSAQAPDPQADAVKERFAQRFEGFDVTAVRRTPYGLFEVQIGTDLLYTDEKVTWVM
EGPLIDALTRRDVTRERQEKLSSVPFEELPLDLAVKQVKGDGSRVMAVFEDPNCGYCKQL
HRTLEDMDNITVYTFLYPILSPDSTTKVRDIWCASDPAKVWKDWMVRGQRPPTAECDAPV
DQWLALGRQLMVRGTPAIFFKSGGRVSGALPRDELEARL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgggccgtcgttttcaggagcaggtatgaatttccggatcacagtctggtgcgcc
gccgccgcggtgtggagctcgggcgccctggcgcaggatggtgccggccaggccgccccg
ggcacgccggacaaggtctactcgaccaccgggagcgcgcccgccaagccgggcgacaag
gtgtattccacccgttcggcgcaggcgcccgatccgcaggccgatgccgtcaaggagcgg
ttcgcgcagcgtttcgaggggttcgacgtgacggcggtgcgacgcaccccgtacgggctg
ttcgaggtgcagatcggaacggatttgctgtacaccgatgaaaaggtcacctgggtcatg
gaggggccgctcatcgacgccctgacccggcgcgatgtcacccgcgaacgccaggaaaaa
ctgtccagcgtcccgttcgaggagctgccgctggacctggcggtcaagcaggtcaagggc
gacggttcgcgcgtcatggccgtattcgaggatccgaactgcggctattgcaagcaactg
caccgcacgctggaggacatggacaacatcacggtctacaccttcctgtatccgatcctc
tcgccggactcgacgaccaaggtgcgcgacatctggtgcgcttcggatcctgccaaggtc
tggaaagactggatggtgcgcggccagcgtccgcccaccgccgagtgcgatgcgccggtc
gaccaatggctggcgctgggccgccagctgatggtgcgcggcacgcccgcgattttcttc
aagagcggcggccgcgtcagcggcgcgctgccgcgcgacgaactcgaagcgcgtctgtag

DBGET integrated database retrieval system