KEGG   Bordetella pertussis Tohama I: BP3403Help
Entry
BP3403            CDS       T00139                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bpe00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bpe00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bpe00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bpe00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3611032..3611940
Genome map
AA seq 302 aa AA seqDB search
MIARGGKKFAASTNFPALPPGVFMQVVRKAVFPVAGMGTRFLPATKAMPKEMLPVVDKPL
IQYAVEEAVAAGITDLIFVTGRNKRAIEDHFDAAPELETDLEAKGKHELLALVRDILPAH
VNCLYIRQSAPLGLGHAVLTAAPAVGNEPFAVLLADDLIDADTPVLKQLIDVAVARQGSV
LGVQEVPREDTRKYGIVASQPVDARTERVTHIVEKPAPEQAPTTLAVVGRYVLEAAIFDH
LRATTVGAGNEIQLTDGIAALLRERDVYAHRYDGKRYDCGSKAGMFQATVALGRKYHGLI
PE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatagccagaggtggtaaaaagtttgccgcttcgacaaattttcccgcacttccccct
ggagttttcatgcaagttgtccgcaaagccgtctttcccgtggccggtatgggcacccgt
tttctgcccgccaccaaggccatgccgaaggaaatgctgccggtcgtggacaaacccctg
atccaatatgccgtcgaagaggccgtcgccgctgggatcaccgacctcatcttcgtcacg
ggccgcaacaagcgggccatcgaagaccatttcgatgccgcccccgagctggaaaccgac
ctggaagcgaagggcaagcacgaactgctggcgctggtccgcgacatcctccccgcgcac
gtgaactgcctgtacatccgccaatcggccccgctgggcctgggacatgccgtgctgacg
gccgcgccggcggtaggcaacgagcccttcgcggtgctgctggccgatgacctgatcgac
gccgacacgccggtgctcaagcagctgatcgacgtggcggtggcgcgccagggcagcgtg
ctgggcgtacaggaggtgccgcgcgaagacacgcgcaaatacggcatcgtggccagccag
ccagtcgatgcgcgcaccgagcgtgtcacccacatcgtcgagaaacccgcccccgagcaa
gcccccaccaccctggcggtcgtcggccgctatgtgctggaggcagccattttcgaccat
ctgcgtgccaccacggtcggggcgggcaatgaaatccagctgacggacggtatcgccgcg
ctgctgcgcgaacgcgacgtctatgcgcaccgctatgacggcaagcgctatgactgcggc
agcaaggcgggcatgttccaggccaccgtggccctgggccgcaaataccacggcctgatt
ccggaataa

DBGET integrated database retrieval system