KEGG   Bordetella pertussis Tohama I: BP3403Help
Entry
BP3403            CDS       T00139                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BP3403
   00052 Galactose metabolism
    BP3403
   00500 Starch and sucrose metabolism
    BP3403
   00520 Amino sugar and nucleotide sugar metabolism
    BP3403
Enzymes [BR:bpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BP3403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3611032..3611940
Genome map
AA seq 302 aa AA seqDB search
MIARGGKKFAASTNFPALPPGVFMQVVRKAVFPVAGMGTRFLPATKAMPKEMLPVVDKPL
IQYAVEEAVAAGITDLIFVTGRNKRAIEDHFDAAPELETDLEAKGKHELLALVRDILPAH
VNCLYIRQSAPLGLGHAVLTAAPAVGNEPFAVLLADDLIDADTPVLKQLIDVAVARQGSV
LGVQEVPREDTRKYGIVASQPVDARTERVTHIVEKPAPEQAPTTLAVVGRYVLEAAIFDH
LRATTVGAGNEIQLTDGIAALLRERDVYAHRYDGKRYDCGSKAGMFQATVALGRKYHGLI
PE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatagccagaggtggtaaaaagtttgccgcttcgacaaattttcccgcacttccccct
ggagttttcatgcaagttgtccgcaaagccgtctttcccgtggccggtatgggcacccgt
tttctgcccgccaccaaggccatgccgaaggaaatgctgccggtcgtggacaaacccctg
atccaatatgccgtcgaagaggccgtcgccgctgggatcaccgacctcatcttcgtcacg
ggccgcaacaagcgggccatcgaagaccatttcgatgccgcccccgagctggaaaccgac
ctggaagcgaagggcaagcacgaactgctggcgctggtccgcgacatcctccccgcgcac
gtgaactgcctgtacatccgccaatcggccccgctgggcctgggacatgccgtgctgacg
gccgcgccggcggtaggcaacgagcccttcgcggtgctgctggccgatgacctgatcgac
gccgacacgccggtgctcaagcagctgatcgacgtggcggtggcgcgccagggcagcgtg
ctgggcgtacaggaggtgccgcgcgaagacacgcgcaaatacggcatcgtggccagccag
ccagtcgatgcgcgcaccgagcgtgtcacccacatcgtcgagaaacccgcccccgagcaa
gcccccaccaccctggcggtcgtcggccgctatgtgctggaggcagccattttcgaccat
ctgcgtgccaccacggtcggggcgggcaatgaaatccagctgacggacggtatcgccgcg
ctgctgcgcgaacgcgacgtctatgcgcaccgctatgacggcaagcgctatgactgcggc
agcaaggcgggcatgttccaggccaccgtggccctgggccgcaaataccacggcctgatt
ccggaataa

DBGET integrated database retrieval system